KEGG   Pan troglodytes (chimpanzee): 453433Help
Entry
453433            CDS       T01005                                 

Gene name
CYP19A1
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ptr00140]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:ptr04913]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 503 aa AA seqDB search
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAMEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttttggaaatgctgaacccgatacattataacatcaccagcatcgtgcctgaagcc
atgcctgctgccaccatgccagtcctgctcctcactggcctttttctcttggtgtggaat
tatgagggcacatcctcaataccaggtcctggctactgcatgggaattggacccctcatc
tcccacggcagattcctgtggatggggattggcagtgcctgcaactactacaaccgggtg
tatggagaattcatgcgagtctggatctctggagaggaaacactcattatcagcaagtcc
tcaagtatgttccacataatgaagcacaatcattacagctctcgattcggcagcaaactt
gggctgcagtgcatcggtatgcatgagaaaggcatcatatttaacaacaatccagagctc
tggaaaacaactcgacccttctttatgaaagctctgtcaggccccggccttgttcgtatg
gtcacagtctgtgctgaatccctcaaaacacatctggacaggttggaggaggtgaccaat
gaatcgggctatgtggacgtgttgacccttctgcgtcgtgtcatgctggacacctctaac
acgctcttcttgaggatccctttggacgaaagtgctatcgtggttaaaatccaaggttat
tttgatgcatggcaagctctcctcatcaaaccagacatcttctttaagatttcttggcta
tacaaaaagtatgagaagtctgtcaaggatttgaaagatgccatggaagttctgatagca
gaaaaaagacgcaggatttccacagaagagaaactggaagaatgtatggactttgccact
gagttgattttagcagagaaacgtggtgacctgacaagagagaatgtgaaccagtgcata
ttggaaatgctgatcgcagctcctgacaccatgtctgtctctttgttcttcatgctattt
ctcattgcaaagcaccctaatgttgaagaggcaataataaaggaaatccagactgttatt
ggtgagagagacataaagattgatgatatacaaaaattaaaagtgatggaaaacttcatt
tatgagagcatgcggtaccagcctgtcgtggacttggtcatgcgcaaagccttagaagat
gatgtaatcgatggctacccagtgaaaaaggggacaaacattatcctgaatattggaagg
atgcacagactcgagtttttccccaaacccaatgaatttactcttgaaaattttgcaaag
aatgttccttataggtactttcagccatttggctttgggccccgtggctgtgcaggaaag
tacatcgccatggtgatgatgaaagccatcctcgttacacttctgagacgattccacgtg
aagacattgcaaggacagtgtgttgagagcatacagaagatacacgacttgtccttgcac
ccagatgagactaaaaacatgctggaaatgatctttaccccaagaaactcagacaggtgt
ctggaacactag

DBGET integrated database retrieval system