KEGG   Pan troglodytes (chimpanzee): 453495Help
Entry
453495            CDS       T01005                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin alpha-1 chain isoform X7
  KO
K10373  tropomyosin 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04260  Cardiac muscle contraction
ptr04261  Adrenergic signaling in cardiomyocytes
ptr05206  MicroRNAs in cancer
ptr05410  Hypertrophic cardiomyopathy (HCM)
ptr05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    453495 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    453495 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    453495 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    453495 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    453495 (TPM1)
Cytoskeleton proteins [BR:ptr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     453495 (TPM1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   453495 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II TMF_DNA_bd IncA ADIP Laminin_I DUF1664 ERM XhlA CENP-F_leu_zip AAA_13 ATG16 DUF745 GAS DUF16 Reo_sigmaC Fib_alpha DUF3584 MAD
Motif
Other DBs
NCBI-GeneID: 453495
NCBI-ProteinID: XP_001173556
Ensembl: ENSPTRG00000007141
UniProt: K7DQU0
Position
15
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaggagaacgccttggat
cgagctgagcaggcggaggccgacaagaaggcggcggaagacaggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcaccgaagatgaactggacaaatac
tctgaggctctcaaagatgcccaggagaagctggagctggcagagaaaaaggccaccgac
gctgaagccgacgtagcttctctgaacagacgcatccagctggttgaggaagagttggat
cgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagca
gatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaagatgaagaaaaa
atggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgc
aaatatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgtgcagag
gagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaactgtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacaga
tatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgggctgag
tttgcggagaggtcggtaactaaattggagaaaagcattgatgacttagaagagaaagtg
gctcatgccaaagaagaaaaccttagtatgcatcagatgctggatcagactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system