KEGG   Pan troglodytes (chimpanzee): 453532Help
Entry
453532            CDS       T01005                                 

Gene name
MAP2K5
Definition
mitogen-activated protein kinase kinase 5
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    453532 (MAP2K5)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    453532 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    453532 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    453532 (MAP2K5)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     453532 (MAP2K5)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   453532 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 438 aa AA seqDB search
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMEIQKNQGSLMPLQ
LLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIVQFNDGNAAVV
SMWVCRALEERRSQQGPP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctagcccttggcccctttcctgccatggagaaccaggtgctggtaattcgc
atcaagatcccaaatagtggcgcggtggactggacagtgcactccgggccgcagttactc
ttcagggatgtgctggatgtgataggccaggttctgcctgaagcaacaactacagcattt
gaatatgaagatgaagatggtgatcgaattacagtgagaagtgatgaggaaatgaaggca
atgctgtcatattattattccacagtaatggaacagcaagtaaatggacaattaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatactcgggccggaccctctcaacacagcagcccagcagtctcagattcactt
ccaagcaatagcttaaagaagtcttctgctgaactgaaaaaaatactagccaatggccag
atgaatgaacaagacatacgatatcgggacactcttggtcatggcaacggaggcacagtc
tacaaagcatatcatgtcccgagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgcgat
tcatcatatatcattggattttatggagcattttttgtagaaaacaggatttcaatatgt
acagaattcatggatgggggatctttggatgtatataggaaaatgccagaacatgtcctt
ggaagaattgcagtagcagttgttaaaggccttacttatttgtggagtttaaagatttta
catagagacgtgaagccctccaatatgctagtaaacacaagaggacaggttaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaaggatttcaggggagcagtatggaattcattctgatgtctgg
agcttaggaatctcttttatggagattcagaaaaaccagggatctttaatgcctctccag
cttctgcagtgcattgttgatgaggattcgcccgtccttccagttggagagttctcggag
ccatttgtacatttcatcactcagtgtatgcgaaaacagccaaaagaaaggccagcacct
gaagaattgatgggccacccgttcatcgtgcagttcaatgatggaaatgccgccgtggtg
tccatgtgggtgtgccgggcactggaggagaggcggagccagcaggggcccccgtga

DBGET integrated database retrieval system