KEGG   Pan troglodytes (chimpanzee): 453575Help
Entry
453575            CDS       T01005                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:ptr04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ptr04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:ptr04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 1257 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDTDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTAIVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGEPPKSPRATRK
FSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKAT
LDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTET
SPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEG
TPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELK
CKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFEN
HSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASE
IIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTK
ALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFS
KMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaatgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagccgctggagaaacagcattacttcacggtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgcaaaagattgtgacgaatgg
gtggcagccattgcacatgccagctacaggaccctcgccacagagcatgaggcattaatg
cagaaatacctgcacctgctgcagatcgtggagacggagaagaccgtggccaagcagctt
cggcagcagatcgaggatggggagatcgagatcgagcggctgaaggcagagatcgcatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgtcgcccccaacgatgaagac
agcgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgg
aagtggaagaccatcatccaggactacatccggtcaccccatgctgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgagtacgtgcagcagctgcac
atccttgtcaacaatttcctgcgcccgctgcggatggccgccagctccaagaagcctccc
atcacacacgacgacgtcagcagcatcttcctgaacagcgaaaccatcatgtttttgcat
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctggtcctggct
gacctatttgacatcctgctgcccatgctcaacatctaccaagagttcgtccgcaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgtgacttcgacaagctgctg
aagcactacgaggccaagcctgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgaccctccatgagctcctggcccacacgcct
catgagcacgttgagcgcaacagcctggactacgccaagtccaaactggaggagctgtcc
agaataatgcacgatgaagtaagtgagacggagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
ggttccctcattcaggtgcccatgtctgaaaagggcaagatcaccagggggcgcctgggg
tctctctccctaaagaaagagggcgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggagggaagcttcacttgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacggaggaggaagccaaaggatccggc
caagacacagatcacttggattttaaaatcggggtggagccaaaggattccccgcccttt
acggtcatcctagtggcctcgtccagacaggagaaggcagcgtggaccagtgacatcagc
cagtgtgtggataacatccgatgcaatgggctcatgatgaacgcatttgaagaaaattcc
aaggtcactgtgccgcagatgatcaagtccgacgcctccttatattgtgatgatgttgac
attcgcttcagcaaaaccatgaactcctgcaaagtgctgcagatccgctacgccagtgtg
gagcggctgctggagaggctgacggacctgcgcttcctgagcatcgacttcctcaacacc
ttcctgcactcctaccgcgtcttcaccaccgccatcgtggtcctggacaagctcattacc
atctacaagaagcctatcagtgccattcctgccaggtcgctggagctcctgtttgccagt
ggccagaacaataagctcctgtacggtgaaccccccaagtccccgcgcgccacccgcaag
ttctcctcgccgccacctctgtccatcaccaagacatcgtcaccgagccgccggcggaag
ctctccctgaacatccccatcatcaccggcggcaaggccctggacctggccgccctcagc
tgcaactccaatggctacaccagcatgtactcggccatgtcgcccttcagcaaggccacg
ctggacaccagcaagctctatgtgtccagcagcttcaccaacaagattccagatgagggc
gatacgacccctgagaagcccgaagacccttcggcgctcagcaagcagagctcagaagtc
tccatgagagaggagtcagatattgatcaaaaccagagtgatgatggtgatactgaaaca
tcaccaactaaatctccaacaacacccaaatcagtcaaaagcaaaaattcttcagagttc
ccgctcttttcctataacaatggagtcgtcatgacctcctgtcgtgaactggacaataac
cgcagtgccttgtcggccgcctctgcctttgccatagcaaccgcgggggccaacgagggc
accccaaacaaggagaagtaccggaggatgtccttagccagtgcagggtttcccccagac
cagaggaatggagacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaac
gtgctccgccactgggtgtccaagcactctcaggactttgagaccaacgatgagctcaaa
tgcaaggtgatcggcttcctggaagaagtcatgcacgacccggagctcctgacccaggag
cggaaggctgcagccaacatcatcaggactctgacccaggaggacccaggtgacaaccag
atcacgctggaggagatcacgcagatggctgaaggcgtgaaggctgagccctttgaaaac
cactcagccctggagatcgcggagcagctgaccctgctagatcacctcgtcttcaagaag
attccttatgaggagttcttcggacaaggatggatgaaactggaaaagaatgaaaggacc
ccttatatcatgaaaaccactaagcacttcaatgacatcagtaacttgattgcttcagaa
atcatccgcaacgaggacatcaacgccagggtgagcgccatcgagaagtgggtggccgta
gctgacatatgccgctgcctccacaactacaatgccgtactggagatcacctcgtccatg
aaccgcagtgcaatcttccggctcaaaaagacgtggctcaaagtctctaagcagactaaa
gctttgattgataagctccaaaagcttgtgtcatctgagggcagatttaagaatctcaga
gaagctctgaaaaattgtgacccaccctgtgtcccttacctggggatgtacctcaccgac
ctggccttcatcgaggaggggacgcccaattacacggaagacggcctggtcaacttctcc
aagatgaggatgatatcccatattatccgagagattcgccagtttcaacaaactgcctac
aaaatagagcaccaagcaaaggtaacgcaatatttactggaccaatcttttgtaatggat
gaagaaagcctctacgagtcttctctcagaatagaaccaaaactccccacctga

DBGET integrated database retrieval system