KEGG   Pan troglodytes (chimpanzee): 453575Help
Entry
453575            CDS       T01005                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    453575 (RASGRF1)
   04010 MAPK signaling pathway
    453575 (RASGRF1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    453575 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 1257 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDTDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTAIVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGEPPKSPRATRK
FSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKAT
LDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTET
SPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEG
TPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELK
CKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFEN
HSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASE
IIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTK
ALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFS
KMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaatgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagccgctggagaaacagcattacttcacggtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgcaaaagattgtgacgaatgg
gtggcagccattgcacatgccagctacaggaccctcgccacagagcatgaggcattaatg
cagaaatacctgcacctgctgcagatcgtggagacggagaagaccgtggccaagcagctt
cggcagcagatcgaggatggggagatcgagatcgagcggctgaaggcagagatcgcatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgtcgcccccaacgatgaagac
agcgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgg
aagtggaagaccatcatccaggactacatccggtcaccccatgctgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgagtacgtgcagcagctgcac
atccttgtcaacaatttcctgcgcccgctgcggatggccgccagctccaagaagcctccc
atcacacacgacgacgtcagcagcatcttcctgaacagcgaaaccatcatgtttttgcat
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctggtcctggct
gacctatttgacatcctgctgcccatgctcaacatctaccaagagttcgtccgcaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgtgacttcgacaagctgctg
aagcactacgaggccaagcctgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgaccctccatgagctcctggcccacacgcct
catgagcacgttgagcgcaacagcctggactacgccaagtccaaactggaggagctgtcc
agaataatgcacgatgaagtaagtgagacggagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
ggttccctcattcaggtgcccatgtctgaaaagggcaagatcaccagggggcgcctgggg
tctctctccctaaagaaagagggcgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggagggaagcttcacttgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacggaggaggaagccaaaggatccggc
caagacacagatcacttggattttaaaatcggggtggagccaaaggattccccgcccttt
acggtcatcctagtggcctcgtccagacaggagaaggcagcgtggaccagtgacatcagc
cagtgtgtggataacatccgatgcaatgggctcatgatgaacgcatttgaagaaaattcc
aaggtcactgtgccgcagatgatcaagtccgacgcctccttatattgtgatgatgttgac
attcgcttcagcaaaaccatgaactcctgcaaagtgctgcagatccgctacgccagtgtg
gagcggctgctggagaggctgacggacctgcgcttcctgagcatcgacttcctcaacacc
ttcctgcactcctaccgcgtcttcaccaccgccatcgtggtcctggacaagctcattacc
atctacaagaagcctatcagtgccattcctgccaggtcgctggagctcctgtttgccagt
ggccagaacaataagctcctgtacggtgaaccccccaagtccccgcgcgccacccgcaag
ttctcctcgccgccacctctgtccatcaccaagacatcgtcaccgagccgccggcggaag
ctctccctgaacatccccatcatcaccggcggcaaggccctggacctggccgccctcagc
tgcaactccaatggctacaccagcatgtactcggccatgtcgcccttcagcaaggccacg
ctggacaccagcaagctctatgtgtccagcagcttcaccaacaagattccagatgagggc
gatacgacccctgagaagcccgaagacccttcggcgctcagcaagcagagctcagaagtc
tccatgagagaggagtcagatattgatcaaaaccagagtgatgatggtgatactgaaaca
tcaccaactaaatctccaacaacacccaaatcagtcaaaagcaaaaattcttcagagttc
ccgctcttttcctataacaatggagtcgtcatgacctcctgtcgtgaactggacaataac
cgcagtgccttgtcggccgcctctgcctttgccatagcaaccgcgggggccaacgagggc
accccaaacaaggagaagtaccggaggatgtccttagccagtgcagggtttcccccagac
cagaggaatggagacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaac
gtgctccgccactgggtgtccaagcactctcaggactttgagaccaacgatgagctcaaa
tgcaaggtgatcggcttcctggaagaagtcatgcacgacccggagctcctgacccaggag
cggaaggctgcagccaacatcatcaggactctgacccaggaggacccaggtgacaaccag
atcacgctggaggagatcacgcagatggctgaaggcgtgaaggctgagccctttgaaaac
cactcagccctggagatcgcggagcagctgaccctgctagatcacctcgtcttcaagaag
attccttatgaggagttcttcggacaaggatggatgaaactggaaaagaatgaaaggacc
ccttatatcatgaaaaccactaagcacttcaatgacatcagtaacttgattgcttcagaa
atcatccgcaacgaggacatcaacgccagggtgagcgccatcgagaagtgggtggccgta
gctgacatatgccgctgcctccacaactacaatgccgtactggagatcacctcgtccatg
aaccgcagtgcaatcttccggctcaaaaagacgtggctcaaagtctctaagcagactaaa
gctttgattgataagctccaaaagcttgtgtcatctgagggcagatttaagaatctcaga
gaagctctgaaaaattgtgacccaccctgtgtcccttacctggggatgtacctcaccgac
ctggccttcatcgaggaggggacgcccaattacacggaagacggcctggtcaacttctcc
aagatgaggatgatatcccatattatccgagagattcgccagtttcaacaaactgcctac
aaaatagagcaccaagcaaaggtaacgcaatatttactggaccaatcttttgtaatggat
gaagaaagcctctacgagtcttctctcagaatagaaccaaaactccccacctga

DBGET integrated database retrieval system