KEGG   Pan troglodytes (chimpanzee): 453714Help
Entry
453714            CDS       T01005                                 

Gene name
EIF3J
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    453714 (EIF3J)
Translation factors [BR:ptr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    453714 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 249 aa AA seqDB search
GLDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEV
KISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDL
ELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCI
SLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGG
YVQDYEDFM
NT seq 751 nt NT seq  +upstreamnt  +downstreamnt
gggactggactcctgggacgccgacgctttctccgtggaagacccagtgcggaaggtggg
gggcggcggcactgccggcggggaccgctgggaaggcgaggacgaggacgaggacgtcaa
ggataactgggatgacgatgatgatgaaaaaaaagaggaagcagaagtaaaaccagaggt
aaaaatttcagaaaagaaaaaaatagcagagaagataaaagagaaagaacggcaacagaa
gaaaaggcaagaagaaattaaaaagaggttagaagaacctgaagaacctaaagtgctaac
accagaagaacaattagcagataaactgcggctaaagaaattacaggaagagtcagacct
cgaattagcaaaggaaacttttggtgttaataatacagtttatggaatagatgctatgaa
cccatcttcaagagatgactttacagagtttggaaagttactaaaagataaaattacaca
atatgaaaagtcactatattatgccagttttttggaagtcttagttcgagatgtgtgtat
ttcattggaaattgatgacttgaaaaaaattaccaattcactgactgtgctttgcagtga
aaaacagaagcaagaaaagcaaagcaaagccaaaaagaagaagaaaggtgtggttcctgg
agggggattaaaagccaccatgaaagatgatctggcagattatggtggttatgatggagg
atatgtacaagactatgaagacttcatgtga

DBGET integrated database retrieval system