KEGG   Pan troglodytes (chimpanzee): 454098Help
Entry
454098            CDS       T01005                                 

Gene name
CES5A
Definition
(RefSeq) carboxylesterase 5A
  KO
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     454098 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 544 aa AA seqDB search
MSGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSPVPVNVFLGV
PFAAPPLGSLRFMNPQPASPWDNLREATSYPNLCFQNSEWLLLDQHMLKVHYPKFGVSED
CLYLNIYAPAHADAGSKLPVLVWFPGGAFKTGSASIFDGSALAAYEDVLVVVIQYRLGIF
GFFTTWDQHAPGNWAFKDQVAALSWVQKNIEFFGGDPSSVTIFGESAGAISVSSLILSPM
AKGLFHKAIMESGVAIIPYLKAHDYEKSEDLQVVAHFCGNNASDSEALLRCLRTKPSKEL
LTLSQKTKSFTRVVDGAFFPNEPLDLLSQKAFKAIPSIIGVNNHECGFLLPMKEAPEILS
GSNKSLALHLIQNILHIPPQYLHLVANEYFHDKHSLTEIRDTLLDLLGDVFFVVPALITA
RYHRDAGAPVYFYEFRHRPQCFEDTKPAFVKADHADEVRFVFGGAFLKGDIVMFEGATEE
DKLLSRKMMKYWATFARTGNPNGNDLSLWPAYNLTEQYLQLDLNMSLGQRLKEPRVEFWT
RTIP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaattgggtgcacccaggccagatcctaatttgggctatctgggtccttgca
gcccccaccaaagggccttctgctgaagggccacagaggaacaccaggctgggatggatt
cagggcaagcaagtcaccgtgctgggaagccctgtgcctgtgaacgtgttcctcggagtc
ccctttgctgctcccccgctgggatccctgcgatttatgaacccgcagcctgcatcgccc
tgggataacttgcgagaagccacctcctaccctaatttgtgcttccagaactcagagtgg
ctgctcttagatcagcacatgctcaaggtgcattaccccaaattcggcgtgtcagaagac
tgcctctatctgaacatctatgcgcctgcccacgccgatgcaggctccaagctccccgtc
ttggtgtggttcccaggaggtgccttcaagactggctcagcctccatctttgatgggtcc
gccctggctgcctatgaggacgtgctggttgtggtcatccagtaccggctaggaatattt
ggtttcttcaccacatgggatcagcatgctccagggaactgggccttcaaggaccaggtg
gctgctctgtcctgggtccagaagaacatcgagttctttggtggggaccccagctctgtg
accatctttggcgagtccgcgggagccataagtgtttctagtcttatactgtctcccatg
gccaaaggcttattccacaaagccatcatggagagtggggtggccatcatcccttacctg
aaggcccatgattatgagaagagtgaggacctgcaggtggttgcacatttctgtggtaac
aatgcgtcagactctgaggccctgctgaggtgcctgaggacaaaaccctccaaggagctg
ctgaccctcagccagaaaacaaagtctttcactcgagtggttgatggtgctttctttcct
aatgagcctctagatctattgtctcagaaagcatttaaagcaattccttccatcatcgga
gtcaataaccacgagtgtggcttcctgctgcctatgaaggaggctcctgagatcctcagt
ggctccaacaagtcccttgccctccatctgatacaaaacatcctgcacatcccgcctcag
tatttgcaccttgtggctaatgaatacttccatgacaagcactccctgactgaaatccga
gacactcttctggacttgcttggagatgtgttctttgtggtccctgcactgatcacagct
cgatatcacagagatgctggtgcacctgtctacttctatgagtttcggcaccggcctcag
tgctttgaagacacgaagccagcttttgtcaaagctgaccacgctgatgaagtccgcttt
gtgttcggtggtgccttcctgaagggtgacattgttatgttcgaaggagccacggaggag
gacaagttactgagccggaagatgatgaaatactgggctacctttgctcgaaccgggaat
cctaatgggaacgacctgtctctgtggccagcttataatctgactgagcagtacctgcag
ctggacttgaacatgagcctcggacagagactcaaagaaccgcgggtggagttttggacc
agaaccatcccctga

DBGET integrated database retrieval system