KEGG   Pan troglodytes (chimpanzee): 454188Help
Entry
454188            CDS       T01005                                 

Gene name
PLA2G15, LYPLA3
Definition
phospholipase A2, group XV
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ptr00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ptr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 412 aa AA seqDB search
MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALLAGRHPPVVLVPGDLGNQLEAKLDKPTV
VHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGK
TFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGD
GTVNLKSALQCQAWQSHQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccacctccgcccctaccgtgtggggctgctcccggatggcctcctgttcctc
ttgctgctgctaatgctgctcgcggacccagcgctcctggccggacgtcaccccccagtg
gtgctggtccctggtgatttgggtaaccaactggaagccaagctggacaagccgacagtg
gtgcactacctctgctccaagaagaccgaaagctacttcacaatctggctgaacctggaa
ctgctgctgcctgtcatcattgactgctggattgacaatatcaggctggtttacaacaaa
acatccagggccacccagtttcctgatggtgtggatgtacgtgtccctggctttgggaag
accttctcactggagttcctggaccccagcaaaagcagcgtgggttcctatttccacacc
atggtggagagccttgtgggctggggctacacacggggtgaggatgtccgaggggctccc
tatgactggcgccgagccccaaatgaaaacgggccctacttcctggccctccgcgagatg
atcgaggagatgtaccagctgtatgggggccccgtggtgctggttgcccacagtatgggc
aacatgtacacgctctactttctgcagcggcagccgcaggcctggaaggacaagtatatc
cgggccttcgtgtcactgggtgcgccctgggggggcgtggccaagaccctgcgcgtcctg
gcttcaggagacaacaaccggatcccagtcatcgggcccctgaagatccgggagcagcag
cggtcagctgtctccaccagctggctgctgccctacaactacacatggtcacctgagaag
gtgttcgtgcagacacccacaatcaactacacactgcgggactaccgcaagttcttccag
gacatcggctttgaagatggctggctcatgcggcaggacacagaagggctggtggaagcc
acgatgccacctggtgtgcagctgcactgcctctatggcactggcgtccccacaccagac
tccttctactatgagagcttccctgaccgtgaccctaaaatctgctttggtgacggcgat
ggtactgtgaacttgaagagtgccctgcagtgccaggcctggcagagccaccaggagcac
caagtgttgctgcaggagctgccaggcagcgagcacatcgagatgctggccaacgccacc
accctggcctatctgaaacgtgtgctccttgggccctga

DBGET integrated database retrieval system