KEGG   Pan troglodytes (chimpanzee): 454287Help
Entry
454287            CDS       T01005                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     454287 (USP10)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   454287 (USP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 780 aa AA seqDB search
MPWLPSPGIGLYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPDGQEYQR
IEFGVGEVIEPSDTSPRTPSYSISSTLNPQAPEFILGCTASKITPDGITKEASYGSIDCQ
YPGSALALDGSSNVEAEVLESDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEAL
VNGHANSAVPNSVSAEDAEFMGDMPPSVTPRTCNSPQNSTDSVSDIVPDSPFPGALGSDT
RTAGQPEGGPGADFGQSCFPAEAGRDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEG
TATNGVELHTTESIDLDPTKPESASPPADGTGSASGILPVSQPKSWASLFHDSKPSSSSP
VAYVETKYSPPAISPLVSEKQVEVKEGLVPVSEDPVAIKIAELLENVTLIHKPVSLQPRG
LINKGNWCYINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFVRLMNEFTNMP
VPPKPRQALGDKIVRDIRPGAAFEPTYIYRLLTVNKSSLSEKGRQEDAEEYLGFILNGLH
EEMLNLKKLLSPSSEKLTISNGPKNHSVNEEEQEEQGEGSEDEWEQVGPRNKTSVTRQAD
FVQTPITGIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESV
QGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKVV
YHHGNSATGGHYTTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDLL
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgccctggttgccctctcctggaatagggctgtatatttttggagattttagccctgat
gaattcaatcaattctttgtgactcctcgatcttcagttgagcttcctccatacagtgga
acagttctgtgtggcacacaggctgtggataaactacccgatggacaagaatatcagaga
attgagtttggtgtcggtgaagtcattgaacccagtgacacttcgccgagaacccccagc
tacagtatttcaagcacactgaaccctcaggcccctgaatttattctcggttgtacagct
tccaaaataacccctgatggtatcactaaagaagcaagctatggctccatcgactgccag
tacccaggctctgccctcgctttggatggaagttctaatgtggaggcggaagttttggaa
agtgatggtgtctcaggtggtcttggacaaagggagcgtaaaaagaagaaaaagcggcca
cctggatattacagctatttgaaagatggtggcgatgatagtatctccacagaagccctg
gtcaatggccatgccaattcagcagtcccgaacagtgtcagtgcagaggatgcagaattt
atgggtgacatgcccccgtcagttacgcccaggacttgtaacagcccccagaactccacg
gactctgtcagtgacattgtgcctgacagtcctttccccggagcactcggcagtgacacc
aggactgcagggcagccggaggggggccccggggctgattttggtcagtcctgcttccct
gcagaggctggcagagacaccctgtcaaggacagctggggctcagccctgcgttggtacc
gatactactgaaaaccttggagttgctaatggacaaatacttgaatcctcgggtgagggc
acagctaccaacggggtggagttgcacaccacggaaagcatagacttggacccaaccaaa
cccgagagtgcatcacctcctgctgacggcacgggctctgcatcaggcatccttcctgtc
agccagcccaagtcctgggccagtctctttcacgattctaagccctcttcctcctcgccg
gtggcctatgtggaaactaagtattcccctcccgccatatctcccctggtttctgaaaag
caggttgaagtcaaagaagggcttgttccggtttcagaggatcctgtagccataaagatt
gcagagttgctggagaatgtaaccctaatccataaaccagtgtcgttgcaaccccgtggg
ctgatcaataaagggaactggtgctacattaatgctacactgcaggcattggttgcttgc
ccgccgatgtaccacctgatgaagttcattcctctgtattccaaagtgcaaaggccttgt
acgtcaacacccatgatagacagctttgttcggctaatgaatgagttcactaatatgcca
gtacctccaaaaccccgacaagctcttggagataaaatcgtgagggatattcgccctgga
gctgcctttgagcccacatatatttacagactcctgacagttaacaagtcaagcctgtct
gaaaagggtcgacaagaagatgctgaggaatacttaggcttcattctaaatggacttcat
gaggaaatgttgaacctaaagaagcttctctcaccaagtagtgaaaaacttacgatttcc
aatggccccaaaaaccactcggtcaatgaagaagagcaggaagaacaaggtgaaggaagc
gaggatgaatgggaacaagtgggcccccggaacaagacttccgtcacccgccaggcggat
tttgttcagactccaatcaccggcatttttggtggacacatcaggtctgtggtttaccag
cagagttcaaaagaatctgccactttgcagccatttttcacgttgcagttggatatccag
tcagacaagatacgcacagtccaggatgcactggagagcttggtggcaagagaatctgtc
caaggttataccacaaaaaccaaacaagaggttgagataagtcgaagagtgactctggaa
aaactccctcctgtcctcgtgctgcacctgaaacgattcgtttatgagaagactggtggg
tgccagaagcttatcaaaaatattgaatatcctgtggacttggaaattagtaaagtggtc
taccatcacggcaacagtgcgacgggcggccattacactacagacgtcttccagatcggt
ctgaatggctggctgcgcatcgatgaccagacagtcaaggtgatcaaccagtaccaggtg
gtgaaaccaactgctgaacgcacagcctacctcctgtattaccgccgagtggacctgctg
taa

DBGET integrated database retrieval system