KEGG   Pan troglodytes (chimpanzee): 454378Help
Entry
454378            CDS       T01005                                 

Gene name
CES3
Definition
carboxylesterase 3
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 210 aa AA seqDB search
MEQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVP
TVSFSRYLRDSGSPVFFYEFQHRPSSFAKIKPAWVKADHGAEGAFVFGGPFLMDESSRLA
FPEATEEEKQLSLTMMAQWTHFARTGDPNSKALPPWPRFNQAEQYLEINPVPRARQKFRE
ARMQFWSETLPSKIQQWHQKQKNRKAQEDL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggagcagatgagccgggaggacatgctggccatctcaacacccgtcttgaccagtctg
gatgtgccccctgagatgatgcccaccgtcatagatgaatacctaggaagcaactcggac
gcacaagccaaatgccaggcattccaggaattcatgggtgacgtattcatcaatgttccc
accgtcagtttttcaagataccttcgagattctggaagccctgtctttttctatgagttc
cagcatcgacccagttcttttgcgaagatcaaacccgcctgggtgaaggctgatcatggc
gccgagggtgcttttgtgttcggaggtcccttcctcatggacgagagctcccgcctggcc
tttccagaggccacagaggaggagaagcagctaagcctcaccatgatggcccagtggacc
cactttgcccggacaggggaccccaatagcaaggctctgcctccttggccccgattcaac
caggcggaacaatatctggagatcaacccagtgccacgggccagacagaagttcagggag
gcccggatgcagttctggtcagagacgctccccagcaagatacaacagtggcaccagaag
cagaagaacaggaaggcccaggaggacctctga

DBGET integrated database retrieval system