KEGG   Pan troglodytes (chimpanzee): 454499Help
Entry
454499            CDS       T01005                                 

Gene name
MAPK7
Definition
mitogen-activated protein kinase 7
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    454499 (MAPK7)
 Cellular Processes
  Cell communication
   04540 Gap junction
    454499 (MAPK7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    454499 (MAPK7)
   04921 Oxytocin signaling pathway
    454499 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    454499 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    454499 (MAPK7)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     454499 (MAPK7)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   454499 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 808 aa AA seqDB search
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGAAPDTIDLTXQPPPNXXXXXXXXXXXXLKAALLKSLR
SRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERERKERGAGAS
GGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPAPTSVPAPAPAPTPTPTPVQPTSPLPG
PVAQPTGPQPQPAGSTSGPVPQPACPPLGPAPHPTGPPGPIPVPVPPQIATSTSLLAAQS
LVPPPGLPGSSTPGILPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKSQVEDPLPP
VFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMN
PADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaaacacgacaacatcatcgccatcaaggacatc
ctgaggcccaccgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctgcaccagattatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgactgag
tatgtggccacgcgctggtaccgtgcgcccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactacgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgaccgcgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccaccg
tgccccggcgctgcacctgacaccattgatctgaccncgcagccacctccgaatcnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnncttaaagctgccctgcttaagtctttgagg
agccggctcagagatggccccagtgcacccctggaggctcctgagcctcggaagccggtg
acagcccaggagcgccagcgggagcgggaggagaagcggcggaggcggcaagaacgagcc
aaggagcgggagaaacggcggcaggagcgggagcgaaaggaacggggggctggggcctct
gggggcccctccactgaccccttggctggactagtgctcagtgacaatgacagaagcctg
ttggaacgctggactcgaatggcccggcccgcagccccagcccccacctctgtgccggcc
cctgccccagcgccaacgccaaccccaaccccagtccaacctaccagtcctcttcctggc
cctgtagcccagcccactggcccgcaaccacaacctgcgggctctacctctggccctgta
ccccagcctgcctgcccaccccttggccctgcaccccaccccactggccctcctgggccc
atccctgtccccgtgccaccccagattgccacctccaccagcctcctggctgcccagtca
cttgtgccaccccctgggctgcctggctccagcaccccagggattttgccttacttccca
cctggcctgccacccccagacgccgggggagcccctcagtcttccatgtcagagtcacct
gatgtcaaccttgtgacccaacagctatctaagtcacaggtggaggaccccctgccccct
gtgttctcaggcacaccaaagggcagtggggctggctacggtgttggctttgacctggag
gaattcttaaaccagtctttcgacatgggcgtggctgatgggccacaggatggccaggca
gattcagcctctctctcagcctccctgcttgctgactggctcgaaggccatggcatgaac
cctgccgatattgagtccctgcagcgtgagatccagatggactccccaatgctgctggct
gacctgcctgacctccaggacccctga

DBGET integrated database retrieval system