KEGG   Pan troglodytes (chimpanzee): 454587Help
Entry
454587            CDS       T01005                                 

Gene name
AP2B1
Definition
(RefSeq) AP-2 complex subunit beta isoform X1
  KO
K11825  AP-2 complex subunit beta-1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04144  Endocytosis
ptr04721  Synaptic vesicle cycle
ptr04961  Endocrine and other factor-regulated calcium reabsorption
ptr05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    454587 (AP2B1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    454587 (AP2B1)
  Nervous system
   04721 Synaptic vesicle cycle
    454587 (AP2B1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    454587 (AP2B1)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    454587 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Arm Cnd3 RTP1_C1 CLASP_N TIP120 Arm_2 Sec7_N
Motif
Other DBs
NCBI-GeneID: 454587
NCBI-ProteinID: XP_001174152
Ensembl: ENSPTRG00000009021
UniProt: H2R1D0
Position
17
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtatttcacaaccaataaaaaaggagaaatatttgaactaaaagct
gaactcaacaatgaaaagaaagaaaagagaaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgttagttctctctttccagacgtagtgaactgtatgcagact
gacaatctggaactgaagaagcttgtgtatctctacttgatgaactacgccaagagtcag
ccagacatggccatcatggctgtaaacagctttgtgaaggactgtgaagatcctaatcct
ttgattcgagccttggcagtcagaaccatggggtgcatccgggtagacaaaattacagaa
tatctctgtgagccgctccgcaagtgcttgaaggatgaggatccctatgttcggaaaaca
gcagcagtctgcgtggcaaaactccatgatatcaatgcccaaatggtggaagatcaggga
tttctggattctctacgggatctcatagcagattcaaatccaatggtggtggctaatgcc
gtagcggcattatctgaaatcagtgagtctcacccaaacagcaacttacttgatctgaac
ccacagaacattaataagctgctgacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgatcgggaggctcagagcatc
tgtgagcgggtaactccccggctatcccatgccaactcagcagtggtgctttcagcggta
aaagtcctaatgaagtttctagaattgttacctaaggattctgactactacaatatgctg
ctgaagaagttagcccctccacttgtcactttgctgtctggggagccagaagtgcagtat
gtcgccctgaggaacatcaacttaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaagtcttctttgtgaagtacaatgatcccatctatgttaaactagagaagttggac
atcatgattcgtttggcatctcaagccaacattgctcaggttctggcagaactgaaagaa
tatgctacagaggtggatgttgactttgttcgaaaagctgtgcgggccattggacggtgt
gccatcaaagtggagcaatctgcagagcgctgtgtaagcacattgcttgatctaatccaa
accaaagtgaattatgtggtccaagaagcaattgttgtcatcagggacatcttccgcaaa
taccccaacaagtatgaaagtatcattgccactctgtgtgagaacttagactcgctggat
gagccagatgctcgagcagctatgatttggattgtgggagaatatgctgaaagaattgac
aatgcagatgagttactagaaagcttcctggagggttttcacgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccatcagaaacacag
gagctagtccagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaactgaccctgttacagctaaagaagta
gtcttgtctgagaagccactgatctctgaggagacggaccttattgagccaactctgctg
gatgagctaatctgccacattggttctttggcctctgtgtatcataagcctcccaatgct
tttgtggaaggaagtcatggaattcatcgtaaacacttgccaattcatcatgggagcact
gatgcaggtgacagccctgttggcactaccactgcaacaaacctggaacagcctcaggtt
atcccctctcaaggtgatcttctaggggatcttttaaaccttgacctcggtcccccagtc
aatgtgccacaggtgtcctccatgcagatgggagcagtggatctcctaggaggaggacta
gatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtgggacaa
tccttcatcccatcatcggtgcctgcaacctttgctccttcacctacacctgctgtggtc
agcagtggactgaatgacctgtttgaactctccacagggataggcatggcacccggtgga
tatgtggctcctaaggctgtctggctacctgcagtaaaggctaaaggcttggagatttca
ggaacatttactcaccgccaagggcacatctatatggaaatgaacttcaccaataaagct
ctgcagcacatgacagattttgcaatccagtttaacaaaaatagctttggtgtcatcccc
agcactcctctggccatccatacaccactgatgccaaaccagagcattgatgtctccctg
cctctcaataccttgggcccagtcatgaagatggaacctctgaataacctccaggtggct
gtgaaaaacaatatcgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggagcgccaggtcttccttgcaacatggaaggatattcccaat
gaaaatgaacttcagtttcagattaaggaatgtcatttaaatgctgacactgtttccagc
aagttgcaaaacaacaatgtttatactattgccaagaggaatgtggaagggcaggacatg
ctgtaccaatccctcaagctcactaatggcatttggattttggccgaactacgtatccag
ccaggaaaccccaattacacgctgtcactgaagtgtagagctcctgaagtctctcaatac
atctatcaggtctatgacagcattttgaaaaactaa

DBGET integrated database retrieval system