KEGG   Pan troglodytes (chimpanzee): 454587Help
Entry
454587            CDS       T01005                                 

Gene name
AP2B1
Definition
adaptor-related protein complex 2, beta 1 subunit
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    454587 (AP2B1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    454587 (AP2B1)
  Nervous system
   04721 Synaptic vesicle cycle
    454587 (AP2B1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    454587 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtatttcacaaccaataaaaaaggagaaatatttgaactaaaagct
gaactcaacaatgaaaagaaagaaaagagaaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgttagttctctctttccagacgtagtgaactgtatgcagact
gacaatctggaactgaagaagcttgtgtatctctacttgatgaactacgccaagagtcag
ccagacatggccatcatggctgtaaacagctttgtgaaggactgtgaagatcctaatcct
ttgattcgagccttggcagtcagaaccatggggtgcatccgggtagacaaaattacagaa
tatctctgtgagccgctccgcaagtgcttgaaggatgaggatccctatgttcggaaaaca
gcagcagtctgcgtggcaaaactccatgatatcaatgcccaaatggtggaagatcaggga
tttctggattctctacgggatctcatagcagattcaaatccaatggtggtggctaatgcc
gtagcggcattatctgaaatcagtgagtctcacccaaacagcaacttacttgatctgaac
ccacagaacattaataagctgctgacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgatcgggaggctcagagcatc
tgtgagcgggtaactccccggctatcccatgccaactcagcagtggtgctttcagcggta
aaagtcctaatgaagtttctagaattgttacctaaggattctgactactacaatatgctg
ctgaagaagttagcccctccacttgtcactttgctgtctggggagccagaagtgcagtat
gtcgccctgaggaacatcaacttaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaagtcttctttgtgaagtacaatgatcccatctatgttaaactagagaagttggac
atcatgattcgtttggcatctcaagccaacattgctcaggttctggcagaactgaaagaa
tatgctacagaggtggatgttgactttgttcgaaaagctgtgcgggccattggacggtgt
gccatcaaagtggagcaatctgcagagcgctgtgtaagcacattgcttgatctaatccaa
accaaagtgaattatgtggtccaagaagcaattgttgtcatcagggacatcttccgcaaa
taccccaacaagtatgaaagtatcattgccactctgtgtgagaacttagactcgctggat
gagccagatgctcgagcagctatgatttggattgtgggagaatatgctgaaagaattgac
aatgcagatgagttactagaaagcttcctggagggttttcacgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccatcagaaacacag
gagctagtccagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaactgaccctgttacagctaaagaagta
gtcttgtctgagaagccactgatctctgaggagacggaccttattgagccaactctgctg
gatgagctaatctgccacattggttctttggcctctgtgtatcataagcctcccaatgct
tttgtggaaggaagtcatggaattcatcgtaaacacttgccaattcatcatgggagcact
gatgcaggtgacagccctgttggcactaccactgcaacaaacctggaacagcctcaggtt
atcccctctcaaggtgatcttctaggggatcttttaaaccttgacctcggtcccccagtc
aatgtgccacaggtgtcctccatgcagatgggagcagtggatctcctaggaggaggacta
gatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtgggacaa
tccttcatcccatcatcggtgcctgcaacctttgctccttcacctacacctgctgtggtc
agcagtggactgaatgacctgtttgaactctccacagggataggcatggcacccggtgga
tatgtggctcctaaggctgtctggctacctgcagtaaaggctaaaggcttggagatttca
ggaacatttactcaccgccaagggcacatctatatggaaatgaacttcaccaataaagct
ctgcagcacatgacagattttgcaatccagtttaacaaaaatagctttggtgtcatcccc
agcactcctctggccatccatacaccactgatgccaaaccagagcattgatgtctccctg
cctctcaataccttgggcccagtcatgaagatggaacctctgaataacctccaggtggct
gtgaaaaacaatatcgatgtcttctacttcagctgcctcatcccactcaatgtgcttttt
gtagaagatggcaaaatggagcgccaggtcttccttgcaacatggaaggatattcccaat
gaaaatgaacttcagtttcagattaaggaatgtcatttaaatgctgacactgtttccagc
aagttgcaaaacaacaatgtttatactattgccaagaggaatgtggaagggcaggacatg
ctgtaccaatccctcaagctcactaatggcatttggattttggccgaactacgtatccag
ccaggaaaccccaattacacgctgtcactgaagtgtagagctcctgaagtctctcaatac
atctatcaggtctatgacagcattttgaaaaactaa

DBGET integrated database retrieval system