KEGG   Pan troglodytes (chimpanzee): 454703Help
Entry
454703            CDS       T01005                                 

Gene name
G6PC
Definition
glucose-6-phosphatase, catalytic subunit
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ptr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ptr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ptr00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ptr04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ptr04151]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:ptr04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:ptr04920]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:ptr04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 346 aa AA seqDB search
MRMEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVG
IKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSAPLIKQFPVTCETGPGSPSG
HAMGTAGVYYVMVTSTLSIFRGKIKPTYRFRCTDVCLSRIYLAAFXSAQVVAGVLSGIAV
AETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEKAQRWCEQPEWV
HIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSSIVASLVLLHVFDS
LKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggaggaaggaatgaatgttctccatgactttgggatccagtcaacacattac
ctccaggtgaattaccaagactcccaggactggttcatcttggtgtccgtgatcgcagac
ctcaggaatgccttctacgtcctcttccccatctggttccatcttcaggaagctgtgggc
attaaactcctctgggtagctgtgattggagactggctcaacctcgtctttaagtggatt
ctctttggacagcgtccatactggtgggttttggataccgactactacagcaacacttcc
gcgcccctgataaagcagttccctgtaacctgtgagactggacccgggagcccctctggc
catgccatgggcacagcaggtgtatactacgtgatggtcacatctactctttccatcttt
cggggaaagataaagccgacctacagatttcggtgcactgatgtctgtctgtcacgaatc
taccttgctgcctttnaaagcgctcaagttgttgctggagtcctgtcaggcattgctgtt
gcagaaactttcagccacatccacagcatctataatgccagcctcaagaaatattttctc
attaccttcttcctgttcagcttcgccatcggattttatctgctgctcaagggactgggt
gtagacctcctgtggactctggagaaagcccagaggtggtgcgagcagccagaatgggtc
cacattgacaccacaccctttgccagcctcctcaagaacctgggcacgctctttggcctg
gggctggctctcaactccagcatgtacagggagagctgcaaggggaaactcagcaagtgg
ctcccattccgcctgagctctattgtagcctccctcgtcctcctgcacgtctttgactcc
ttgaaacccccatcccaagtcgagctggtcttctacgtcttgtccttctgcaagagtgcg
gtagtgcccctggcatccgtcagtgtcatcccctactgcctcgcccaggtcctgggccag
ccgcacaagaagtcgttgtaa

DBGET integrated database retrieval system