KEGG   Pan troglodytes (chimpanzee): 454703Help
Entry
454703            CDS       T01005                                 

Gene name
G6PC
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit
  KO
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    454703 (G6PC)
   00052 Galactose metabolism
    454703 (G6PC)
   00500 Starch and sucrose metabolism
    454703 (G6PC)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    454703 (G6PC)
   04151 PI3K-Akt signaling pathway
    454703 (G6PC)
   04152 AMPK signaling pathway
    454703 (G6PC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    454703 (G6PC)
   04922 Glucagon signaling pathway
    454703 (G6PC)
   04920 Adipocytokine signaling pathway
    454703 (G6PC)
  Digestive system
   04973 Carbohydrate digestion and absorption
    454703 (G6PC)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    454703 (G6PC)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     454703 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
17
AA seq 359 aa AA seqDB search
MRMEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVG
IKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSAPLIKQFPVTCETGPGSPSG
HAMGTAGVYYVMVTSTLSIFRGKIKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFP
HQVVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTL
EKAQRWCEQPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWLPFRLSS
IVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaggatggaggaaggaatgaatgttctccatgactttgggatccagtcaacacattac
ctccaggtgaattaccaagactcccaggactggttcatcttggtgtccgtgatcgcagac
ctcaggaatgccttctacgtcctcttccccatctggttccatcttcaggaagctgtgggc
attaaactcctctgggtagctgtgattggagactggctcaacctcgtctttaagtggatt
ctctttggacagcgtccatactggtgggttttggataccgactactacagcaacacttcc
gcgcccctgataaagcagttccctgtaacctgtgagactggacccgggagcccctctggc
catgccatgggcacagcaggtgtatactacgtgatggtcacatctactctttccatcttt
cggggaaagataaagccgacctacagatttcggtgcttgaatgtcattttgtggttggga
ttctgggctgtgcagctgaatgtctgtctgtcacgaatctaccttgctgctcattttcct
catcaagttgttgctggagtcctgtcaggcattgctgttgcagaaactttcagccacatc
cacagcatctataatgccagcctcaagaaatattttctcattaccttcttcctgttcagc
ttcgccatcggattttatctgctgctcaagggactgggtgtagacctcctgtggactctg
gagaaagcccagaggtggtgcgagcagccagaatgggtccacattgacaccacacccttt
gccagcctcctcaagaacctgggcacgctctttggcctggggctggctctcaactccagc
atgtacagggagagctgcaaggggaaactcagcaagtggctcccattccgcctgagctct
attgtagcctccctcgtcctcctgcacgtctttgactccttgaaacccccatcccaagtc
gagctggtcttctacgtcttgtccttctgcaagagtgcggtagtgcccctggcatccgtc
agtgtcatcccctactgcctcgcccaggtcctgggccagccgcacaagaagtcgttgtaa

DBGET integrated database retrieval system