KEGG   Pan troglodytes (chimpanzee): 454721Help
Entry
454721            CDS       T01005                                 

Gene name
HDAC5
Definition
histone deacetylase 5
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    454721 (HDAC5)
  Substance dependence
   05034 Alcoholism
    454721 (HDAC5)
  Infectious diseases
   05169 Epstein-Barr virus infection
    454721 (HDAC5)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     454721 (HDAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 1122 aa AA seqDB search
MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEEDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccaacgagtcggatgggatgtcaggccgggaaccatccttggaaatcctg
ccgcggacttctctgcacagcatccctgtgacagtggaggtgaagccggtgctgccaaga
gccatgcccagttccatggggggtgggggtggaggcagccccagccctgtggagctacgg
ggggctctggtgggctctgtggaccccacactgcgggagcagcaactgcagcaggagctc
ctggcgctcaagcagcagcagcagctgcagaagcagctcctgttcgctgagttccagaaa
cagcatgaccacctgacaaggcagcatgaagtccagctgcagaagcacctcaagcagcag
caggagatgctggcagccaagcagcagcaggagatgctggcagccaagcggcagcaggag
ctggagcagcagcggcagcgggagcagcagcggcaggaagagctggagaagcagcggctg
gagcagcagctgctcatcctgcggaacaaggagaagagcaaagagagtgccattgccagc
accgaggtaaagctgaggctccaggaattcctcttgtcgaagtcaaaggagcccacacca
ggcggcctcaaccattccctcccacagcaccccaaatgctggggagcccaccatgcttct
ttggaccagagttcccctccccagagcggcccccctgggacgcctccctcctacaaactg
cctttgcctgggccctacgacagtcgagacgacttccccctccgcaaaacagcctctgaa
cccaacttgaaagtgcgttcaaggctaaaacagaaggtggccgagcggagaagcagtccc
ctcctgcgtcgcaaggatgggactgttattagcacctttaagaagagagctgttgagatc
acaggtgccgggcctggggcgtcgtccgtgtgtaacagcgcacccggctccggccccagc
tctcccaacagctcccacagcaccatcgctgagaatggctttactggctcagtccccaac
atccccactgagatgctccctcagcaccgagccctccctctggacagctcccccaaccag
ttcagcctctacacgtctccttctctgcccaacatctccctagggctgcaggccacggtc
actgtcaccaactcacacctcactgcctccccgaagctgtcgacacagcaggaggccgag
aggcaggccctccagtccctgcggcagggtggcacgctgacaggcaagttcatgagcaca
tcctctattcctggctgcctgctgggcgtggcactggagggcgacgggagcccccacggg
catgcctccctgctgcagcatgtgctgttgctggagcaggcccggcagcagagtaccctc
attgctgtgccactccacgggcagtccccactagtgacgggtgaacgtgtggccaccagc
atgcggacggtaggcaagctcccgcggcatcggcccctgagccgcactcagtcctcaccg
ctgccgcagagtccccaggccctgcagcagctggtcatgcaacaacagcaccagcagttc
ctggagaagcagaagcagcagcagctacagctgggcaagatcctcaccaagacaggggag
ctgcccaggcagcccaccacccaccctgaggagacagaggaggagctgacagagcagcag
gaggtcttgctgggggagggagccctgaccatgccccgggagggctccacagagagtgag
agcacacaggaagacctggaggaggaggacgaggaagaggatggggaggaggaggaggat
tgcatccaggttaaggacgaggagggcgagagtggtgctgaggaggggcccgacttggag
gagcctggtgctggatacaaaaaactgttctcagatgcccagccgctgcagcctttgcag
gtgtaccaggcgcccctcagcctggccactgtgccccaccaggccctgggccgtacccag
tcctcccctgctgcccctgggggcatgaagagccccccagaccagcccgtcaagcacctc
ttcaccacaggtgtggtctacgacacgttcatgctaaagcaccagtgcatgtgcgggaac
acacacgtgcaccctgagcatgctggccggatccagagcatctggtcccggctgcaggag
acaggcctgcttagcaagtgcgagcggatccgaggtcgcaaagccacgctagatgagatc
cagacagtgcactctgaataccacaccctgctctatgggaccagtcccctcaaccggcag
aagctagacagcaagaagttgctcggccccatcagccagaagatgtatgctgtgctgcct
tgtgggggcatcggggtggacagtgacaccgtgtggaatgagatgcactcctccagtgct
gtgcgcatggcagtgggctgcctgctggagctggccttcaaggtggctgcaggagagctc
aagaatggatttgccatcatccggcccccaggacaccacgccgaggaatccacagccatg
ggattctgcttcttcaactctgtagccatcaccgcaaaactcctacagcagaagttgaac
gtgggcaaggtcctcatcgtggactgggacattcaccatggcaatggcacccagcaggcg
ttctacaatgacccctctgtgctctacatctctctgcatcgctatgacaacgggaacttc
tttccaggctctggggctcctgaagaggttggtggaggaccaggcgtggggtacaatgtg
aacgtggcatggacaggaggtgtggacccccccattggagacgtggagtaccttacagcc
ttcaggacagtggtgatgcccattgcccacgagttctcacctgatgtggtcctagtctcc
gccgggtttgatgctgttgaaggacatctgtctcctctgggtggctactctgtcaccgcc
agatgttttggccacttgaccaggcagctgatgaccctggcagggggccgggtggtgctg
gccctggagggaggccatgacttgaccgccatctgtgatgcctctgaggcttgtgtctcg
gctctgctcagtgtagagctgcagcccttggatgaggcagtcttgcagcaaaagcccaac
atcaacgcagtggccacgctagagaaagtcatcgagatccagagcaaacactggagctgt
gtgcagaagttcgccgctggtctgggccggtccctgcgagaggcccaagcaggtgagacc
gaggaggccgagactgtgagcgccatggccttgctgtcggtgggggccgagcaggcccag
gctgcggcagcccgggaacacagccccaggccggcagaggagcccatggagcaggagcct
gccctgtga

DBGET integrated database retrieval system