KEGG   Pan troglodytes (chimpanzee): 454815Help
Entry
454815            CDS       T01005                                 

Gene name
CDC27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    454815 (CDC27)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    454815 (CDC27)
   04114 Oocyte meiosis
    454815 (CDC27)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    454815 (CDC27)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    454815 (CDC27)
Protein phosphatases and associated proteins [BR:ptr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     454815 (CDC27)
Ubiquitin system [BR:ptr04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     454815 (CDC27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 763 aa AA seqDB search
MASTKPLCLPRCGFPRRTPLCRRLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLL
GHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLP
NSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVIS
PDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNY
TNTPSVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQ
VLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQP
NINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNC
KEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYST
TLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYA
YAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKA
LDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKS
ALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDK
RYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcactaaaccactatgcttaccgagatgcggttttcctcgcagaacgccttta
tgcagaaggcttgcagaaggggaacaaatcttatctggtggagtgtttaataagcagaaa
agccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattgttg
ggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaagagc
cttagtttaaatcctttcctctggtctccctttgaatcattatgcgaaataggtgaaaag
ccagatcctgaccaaacatttaaattcacatctttacagaactttagcaactgtctgccc
aactcttgcacaacacaagtacctaatcatagtttatctcacagacagcctgagacagtt
cttacggaaacaccccaggacacaattgaattaaacagattgaatttagaatcttccaat
tcaaagtactccttgaatacagattcctcagtgtcttatattgattcagctgtaatttca
cctgatactgtcccactgggaacaggaacttccatattatctaaacaggttcaaaataaa
ccaaaaactggtcgaagtttattaggaggaccagcagctcttagtccattaaccccaagt
tttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaactac
actaatacaccttctgtaattgatgtgccatccaccggagccccttcaaaaaagtctgtt
gccagaatcggccaaactggaacaaagtctgtcttctcacagagtggaaatagccgagag
gtaactccaattcttgcacaaacacaaagttctggtccacaaacaagtacaacacctcag
gtattgagccccactattacatctcccccaaacgcactgcctcgaagaagttcacgactc
tttactagtgacagctccacaaccaaggagaatagcaaaaaattaaaaatgaagtttcca
cctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataactcaacct
aacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaagggaaa
atatccacaatcacacctcagattcaggcctttaatctacaaaaagcagcagcagaaggt
ttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatacaactgc
aaagaagctataaatattttgagccatctaccttctcaccactacaatactggttgggta
ctgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaaagaata
ttctcagaggttagaaggattgagaattatagagttgaaggcatggagatctactctaca
acactttggcatcttcaaaaagatgttgctctttcagttctgtcaaaagacttaacagac
atggataaaaattcgccagaggcctggtgtgctgcagggaactgtttcagtctgcaacgg
gaacatgatattgcaattaaattcttccagagagctatccaagttgatccaaattatgct
tatgcctatactctattagggcatgagtttgtcttaactgaagaattggacaaagcatta
gcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatggtatggttta
ggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccaaaaagcg
cttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcaacatgca
ctgaaaaaatcagagaaggctttggataccctaaacaaagccattgtcattgatcccaag
aaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatataagtct
gctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtttacttc
ttaataggaaaggtttacaagaagttaggtcaaacgcacctcgccctgatgaatttctct
tgggctatggatttagatcctaaaggagccaataaccagattaaagaggcaattgataag
cgttatcttccagatgatgaggagccaataacccaagaagaacagatcatgggaacagat
gaatcccaggagagcagcatgacagatgcggatgacacacaacttcatgcagctgaaagt
gatgaattttaa

DBGET integrated database retrieval system