KEGG   Pan troglodytes (chimpanzee): 454970Help
Entry
454970            CDS       T01005                                 

Gene name
P4HB
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    454970 (P4HB)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     454970 (P4HB)
Exosome [BR:ptr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   454970 (P4HB)
  Exosomal proteins of colorectal cancer cells
   454970 (P4HB)
  Exosomal proteins of bladder cancer cells
   454970 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 508 aa AA seqDB search
MVRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALA
PEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGR
EADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAID
DIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDSKLSNFKTAAESFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQEL
PEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD
DDDLEDLEEAEEPDMEEDDDQKAVKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgccgcgctctgctgtgcctggccgtggccgccctggtgcgcgccgacgccccc
gaggaggaggaccacgtcctggtgctgcggaaaagcaacttcgcggaggcgctggcggcc
cacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggctctggcc
cctgagtatgccaaagccgctgggaagctgaaggcagaaggttccgagatcaggttggcc
aaggtggacgccacggaggagtctgacctggcccagcagtacggcgtgcgcggctatccc
accatcaagttcttcaggaatggagacacggcttcccccaaggaatatacagctggcaga
gaggctgatgacatcgtgaactggctgaagaagcgcacgggcccggctgccaccaccctg
cctgacggcgcagctgcagagtccttggtggagtccagcgaggtggctgtcatcggcttc
ttcaaggacgtggagtcggactctgccaagcagtttttgcaggcagcagaggccatcgat
gacataccatttgggatcacttccaacagtgacgtgttctccaaataccagctcgacaaa
gatggggttgtcctctttaagaagtttgatgaaggccggaacaactttgaaggggaggtc
accaaggagaacctgctggactttatcaaacacaaccagctgccccttgtcatcgagttc
accgagcagacagccccgaagatttttggaggtgaaatcaagactcatatcctgctgttc
ttgcccaagagtgtgtctgactatgacagcaaactgagcaacttcaaaacagcagccgag
agcttcaagggcaagatcctgttcatcttcatcgacagcgaccacaccgacaaccagcgc
atccttgagttctttggcctgaagaaggaagagtgcccggccgtgcgcctcatcaccctg
gaggaggagatgaccaagtacaagcccgaatcggaggagctgacggcagagaggatcaca
gagttctgccaccgcttcctggagggcaaaatcaagccccacctgatgagccaggagctg
ccggaggactgggacaagcagcctgtcaaggtgcttgttgggaagaactttgaagacgtg
gcttttgatgagaaaaaaaacgtctttgtggagttctatgccccatggtgtggtcactgc
aaacagttggctcccatttgggataaactgggagagacgtacaaggaccatgagaacatc
gtcatcgccaagatggactcgactgctaacgaggtggaggccgtcaaagtgcacagcttc
cccacactcaagttctttcctgccagtgctgacaggacggtcatcgattacaacggggaa
cgcacgctggatggttttaagaagttcctggagagcggtggccaggatggggcaggggat
gatgatgatctcgaggacctggaagaagcagaggagccagacatggaggaagatgatgat
cagaaagctgtgaaagacgaactgtaa

DBGET integrated database retrieval system