KEGG   Pan troglodytes (chimpanzee): 454992Help
Entry
454992            CDS       T01005                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ptr00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 486 aa AA seqDB search
MSGSTPFQMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRA
KYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEA
ESLALVGAMIDQVLELHPGAQRLHVGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRA
VASRVKARRPSVTPLVWDDMLPDLPEDQLAASGVPQLVEPVLWDYTADLDVHGKVLLMQK
YRRCGFPRLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQR
YDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEITDPVREGAGSF
PGSNILALVTQVSLHLRSSVDALLEGNRYVTGWFSPYHRQRKLIHPVMVQHIQPAALSLL
AQWSTLVQELEAALQLAFYPDAVEEWLEENVHPSLQRLQALLQDLSEVSAPPLPPTSPGR
DVAQDP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttccacgccatttcagatgagattagttcatttagaccttaaaggagctcca
ccaaaggtctcgtacctctcagagatttttcctctgttccgtgcactaggtgcaaacggc
ctcctcattgagtatgaagacatgtttccctacgagggccctctgaggctgctgagggcc
aagtacgcctacagcccctctgaaatcaaagagatcttgcatctggctggactcaatgag
ctggaggtgattcccttggtgcagacatttggacacatggagtttgtgctgaagcacacg
gccttcgcccacctgcgggaggtgggctccttcccctgcaccctgaacccccacgaggca
gagtccctggcgctggtgggcgccatgattgaccaggtcctggagctacacccaggcgcc
cagcggctgcacgtcgggtgtgatgaggtctattacctcggagagggggaggcctcgcgc
cggtggctacagcaagagcagaacagcacggggaagttgtgcctgtcacacatgcgggcg
gtggccagccgcgtgaaggcccggcgccccagcgtgacacccctggtgtgggacgacatg
ctcccagacctgcctgaggaccagctcgcagcgtccggggtgccgcagctggtggagccg
gtgctctgggactacacggccgacctggatgtgcacggcaaggtcctcctcatgcagaag
taccggcggtgcggctttccgcggctgtgggcagccagtgccttcaagggtgccacgggg
cccagccaggccgtgccccctgttgagcaccacctcaggaaccatgtgcagtggctgcag
gtggcgggcagcgggcccacggactcactgcagggcatcatcctgaccggctggcagagg
tacgaccactactctgtgctgtgcgagctgctgcccgcaggagtcccgtccctggccgcc
tgcctgcagttgcttctacgcggaggatttgatgaagatgtcaaagcgaaagtggagaac
cttctcgggatttccagcctggaaataacggaccctgttagggagggggccggctctttc
cctggcagcaacatccttgcccttgtcacacaagtcagcctccatctgcgcagctctgtg
gacgcgctgctggagggcaacaggtatgtcactggctggttcagcccctaccaccgccag
cggaagctcatccacccggtcatggttcagcacatccagcccgcagcgctcagcctcctg
gcgcagtggagcaccctcgtgcaggagctggaggctgccctgcagctggctttctacccg
gatgccgtggaggagtggctggaggaaaacgtgcaccccagcctgcagcggctgcaagct
ctgctgcaggacctcagcgaggtgtctgcccccccgctgccacccaccagccctggcagg
gacgttgctcaggacccctga

DBGET integrated database retrieval system