KEGG   Pan troglodytes (chimpanzee): 454992Help
Entry
454992            CDS       T01005                                 

Gene name
HEXDC
Definition
(RefSeq) hexosaminidase D isoform X1
  KO
K14459  hexosaminidase [EC:3.2.1.52]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00511  Other glycan degradation
ptr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    454992 (HEXDC)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     454992 (HEXDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20
Motif
Other DBs
NCBI-GeneID: 454992
NCBI-ProteinID: XP_024206544
Ensembl: ENSPTRG00000009803
Position
17
AA seq 550 aa AA seqDB search
MSGSTPFQMRLVHLDLKGAPPKVSYLSEIFPLFRALGANGLLIEYEDMFPYEGPLRLLRA
KYAYSPSEIKEILHLAGLNELEVIPLVQTFGHMEFVLKHTAFAHLREVGSFPCTLNPHEA
ESLALVGAMIDQVLELHPGAQRLHVGCDEVYYLGEGEASRRWLQQEQNSTGKLCLSHMRA
VASRVKARRPSVTPLVWDDMLPDLPEDQLAASGVPQLVEPVLWDYTADLDVHGKVLLMQK
YRRCGFPRLWAASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQR
YDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVENLLGISSLEITDPVREGAGSF
PGSNILALVTQVSLHLRSSVDALLEGNSRPTAALVARGTPLCGFAPGMSLAGSAPTTASG
SSSTRSWFSTSSPQRSASWRSGAPSCRSWRLPCSWLSTRMPWRSGWRKTCTPACSGCKLC
CRTSARCLPPRCHPPALAGTLLRTPEGRAHARGLLLEAGGGSALPNGPGNRGPRGRRALW
PSSVLPTLSS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggttccacgccatttcagatgagattagttcatttagaccttaaaggagctcca
ccaaaggtctcgtacctctcagagatttttcctctgttccgtgcactaggtgcaaacggc
ctcctcattgagtatgaagacatgtttccctacgagggccctctgaggctgctgagggcc
aagtacgcctacagcccctctgaaatcaaagagatcttgcatctggctggactcaatgag
ctggaggtgattcccttggtgcagacatttggacacatggagtttgtgctgaagcacacg
gccttcgcccacctgcgggaggtgggctccttcccctgcaccctgaacccccacgaggca
gagtccctggcgctggtgggcgccatgattgaccaggtcctggagctacacccaggcgcc
cagcggctgcacgtcgggtgtgatgaggtctattacctcggagagggggaggcctcgcgc
cggtggctacagcaagagcagaacagcacggggaagttgtgcctgtcacacatgcgggcg
gtggccagccgcgtgaaggcccggcgccccagcgtgacacccctggtgtgggacgacatg
ctcccagacctgcctgaggaccagctcgcagcgtccggggtgccgcagctggtggagccg
gtgctctgggactacacggccgacctggatgtgcacggcaaggtcctcctcatgcagaag
taccggcggtgcggctttccgcggctgtgggcagccagtgccttcaagggtgccacgggg
cccagccaggccgtgccccctgttgagcaccacctcaggaaccatgtgcagtggctgcag
gtggcgggcagcgggcccacggactcactgcagggcatcatcctgaccggctggcagagg
tacgaccactactctgtgctgtgcgagctgctgcccgcaggagtcccgtccctggccgcc
tgcctgcagttgcttctacgcggaggatttgatgaagatgtcaaagcgaaagtggagaac
cttctcgggatttccagcctggaaataacggaccctgttagggagggggccggctctttc
cctggcagcaacatccttgcccttgtcacacaagtcagcctccatctgcgcagctctgtg
gacgcgctgctggagggcaacagccgccccacggctgccttggtagcccgcggcacaccc
ctatgtggatttgccccaggtatgtcactggctggttcagcccctaccaccgccagcgga
agctcatccacccggtcatggttcagcacatccagcccgcagcgctcagcctcctggcgc
agtggagcaccctcgtgcaggagctggaggctgccctgcagctggctttctacccggatg
ccgtggaggagtggctggaggaaaacgtgcaccccagcctgcagcggctgcaagctctgc
tgcaggacctcagcgaggtgtctgcccccccgctgccacccaccagccctggcagggacg
ttgctcaggacccctgaggggagagctcatgccagggggctcctgctggaggctgggggg
ggctctgcgctgccaaatggcccgggcaataggggcccacgtgggcgtcgtgccctctgg
cccagcagtgtcttgcccacactcagttcctga

DBGET integrated database retrieval system