KEGG   Pan troglodytes (chimpanzee): 455065Help
Entry
455065            CDS       T01005                                 

Gene name
MAP2K4
Definition
mitogen-activated protein kinase kinase 4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    455065 (MAP2K4)
   04012 ErbB signaling pathway
    455065 (MAP2K4)
   04668 TNF signaling pathway
    455065 (MAP2K4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    455065 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    455065 (MAP2K4)
  Endocrine system
   04912 GnRH signaling pathway
    455065 (MAP2K4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    455065 (MAP2K4)
   05164 Influenza A
    455065 (MAP2K4)
   05161 Hepatitis B
    455065 (MAP2K4)
   05169 Epstein-Barr virus infection
    455065 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    455065 (MAP2K4)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     455065 (MAP2K4)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   455065 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 410 aa AA seqDB search
MAAPSPSGGGGSGGGSSSGTPGPVGSPAPIHPAVSSMQGFQINFCEKAQSKRKALKLNFA
NPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIG
RGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALF
REGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRD
IKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSD
VWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLT
KDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcagcagcggcacc
cccggccccgtagggtccccggcgcctattcacccggccgtcagcagcatgcagggcttt
cagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaattttgca
aatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagttcaa
aacccacacatagagagactgagaacacacagcattgagtcatcaggaaaactgaagatc
tcccctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaattgga
cgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatggca
gttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggatttg
gatgtagtaatgcggagtagtgattgcccatacattgttcagttttatggtgcactcttc
agagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttac
aaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcact
ttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacagagat
atcaaaccttccaatattcttctggacagaagtggaaatattaagctctgtgacttcggc
atcagtggacagcttgtggactctattgccaagacaagagatgctggctgtaggccatac
atggcacctgaaagaatagacccaagcgcatcacgacaaggatatgatgtccgctctgat
gtctggagtttggggatcacattgtatgagttggccacaggccgatttccttatccaaag
tggaatagtgtatttgatcaactaacacaagtcgtgaaaggagatcctccgcagctgagt
aattctgaggaaagggaattctccccgagtttcatcaactttgtcaacttgtgccttacg
aaggatgaatccaaaaggccaaagtataaagagcttctgaaacatccctttattttgatg
tatgaagaacgtgccgttgaggtcgcatgctatgtttgtaaaatcctggatcaaatgcca
gctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system