KEGG   Pan troglodytes (chimpanzee): 455065Help
Entry
455065            CDS       T01005                                 

Gene name
MAP2K4
Definition
mitogen-activated protein kinase kinase 4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ptr04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:ptr04012]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:ptr04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:ptr04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:ptr04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:ptr04912]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:ptr05166]
Human Diseases; Infectious diseases; Influenza A [PATH:ptr05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:ptr05161]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:ptr05169]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:ptr05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 410 aa AA seqDB search
MAAPSPSGGGGSGGGSSSGTPGPVGSPAPIHPAVSSMQGFQINFCEKAQSKRKALKLNFA
NPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIG
RGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALF
REGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRD
IKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSD
VWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLT
KDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcagcagcggcacc
cccggccccgtagggtccccggcgcctattcacccggccgtcagcagcatgcagggcttt
cagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaattttgca
aatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagttcaa
aacccacacatagagagactgagaacacacagcattgagtcatcaggaaaactgaagatc
tcccctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaattgga
cgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaataatggca
gttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggatttg
gatgtagtaatgcggagtagtgattgcccatacattgttcagttttatggtgcactcttc
agagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttac
aaatatgtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcact
ttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacagagat
atcaaaccttccaatattcttctggacagaagtggaaatattaagctctgtgacttcggc
atcagtggacagcttgtggactctattgccaagacaagagatgctggctgtaggccatac
atggcacctgaaagaatagacccaagcgcatcacgacaaggatatgatgtccgctctgat
gtctggagtttggggatcacattgtatgagttggccacaggccgatttccttatccaaag
tggaatagtgtatttgatcaactaacacaagtcgtgaaaggagatcctccgcagctgagt
aattctgaggaaagggaattctccccgagtttcatcaactttgtcaacttgtgccttacg
aaggatgaatccaaaaggccaaagtataaagagcttctgaaacatccctttattttgatg
tatgaagaacgtgccgttgaggtcgcatgctatgtttgtaaaatcctggatcaaatgcca
gctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system