KEGG   Pan troglodytes (chimpanzee): 455080Help
Entry
455080            CDS       T01005                                 

Gene name
USP43, WDR16
Definition
ubiquitin specific peptidase 43
Orthology
K11856  
ubiquitin carboxyl-terminal hydrolase 43 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     455080 (USP43)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   455080 (USP43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 1123 aa AA seqDB search
MDLGPGDAAGGGLLAPRPRRRRSLRRLFSRFLLALGSRSRPGDSPPRPQPGHCDGDGEGG
FACAPGPVPAAPGSPGEERPPGPQPQLQLPAGDGARPPGAQGLKNHGNTCFMNAVVQCLS
NTDLLAEFLALGRYQAAPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGSQFQG
NSQHDALEFLLWLLDRVHEDLEGSSRGPVSEKLPPEATKTSENCLSPSAQLPLGQSFVQS
HFQAQYRSSLTCPHCLKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFPSKSQRFLRVGLAV
PILSTVAALRKMVAEEGGVPADEVILVELYPSGFQRSFFDEEDLNTIAEGDNVYAFQVPP
SPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFL
IREDRAVSWAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKDSRPLC
HWAVDRVLHLRRPGGPPHVKLAVEWDSSVKERLFGSLQEERAQDADSVWQQQQAHQQHSC
TLDECFQFYTKEEQLAQDDAWKCPHCQVLQQGMVKLSLWTLPDILIIHLKRFCQVGERRN
KLSTLVKFPLSGLNMAPHVAQRSTSPEAGLGPWPSWKQPDCLPTSYPLDFLYDLYAVCNH
HGNLQGGHYTAYCRNSLDGQWYSYDDSTVEPLREDEVNTRGAYILFYQKRNSIPPWSASS
SMRGSTSSSLSDHWLLRLGSHAGSTRGSLLSWSSAPCPSLPQVPDSPIFTNSLCNQEKGG
LESRRLVRGVKGRSISMKAPTTSRAKQGPFKTMPLRWSFGSKEKPPGASVELVEYLESRR
RPRSTSQSIVSLLTGTAGEDEKSASPRSNVALLANSEDGGQAIERGPAGVPCPSAQPNHC
LAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQ
MGSKSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNERAEVSPQV
PPVSLVSGGLSPAMDGQAPGSPPALRIPEGLARGLGSRLERDVWSAPSSLRLPRKASRAP
RGSALGMSQRTVPGEQASYGTFQRVKYHTLSLGRKKTLPESSF
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atggacctgggccccggggacgcggcaggagggggactgctcgcgccccggccccgccgc
cgccgctccctgcgccgcctgttcagccgcttcctgctggcgctgggcagccgctcacgc
cccggggactcaccgccccggccccagccgggacactgtgatggcgacggtgaggggggc
ttcgcctgcgccccgggcccagttccagcggcccccgggagccccggggaggaacgcccg
cccggaccccagccccagctccagctccccgccggcgatggggcgcggccgccgggcgct
cagggcttgaagaaccacggcaacacctgtttcatgaacgcggtggtgcagtgtctcagc
aacaccgacctgctggccgagttcctggcgctggggcgctaccaggcggcgccgggccgc
gccgaggtcaccgagcagctggcggcgctggtgcgcgcgctctggactcgcgaatacacg
ccccaactttccgcggagttcaagaatgcagtttccaagtacggctctcagttccaaggc
aattcccagcacgacgccctggaattcctgctctggttgctggatcgtgtacatgaggac
ctggagggttcatcccgagggccggtgtcggagaagcttccgcctgaagccactaaaacc
tctgagaactgcctgtcaccatcagctcagcttcctctaggtcaaagctttgtgcaaagc
cactttcaagcacaatatagatcttccttgacttgtccccactgcctgaaacagagcaac
acctttgatcctttcctgtgtgtgtccctacctatccccttgcgccagacgaggttcttg
agtgtcaccttggtcttcccctctaagagccagcggttcctgcgggttggcttggccgtg
ccaatcctcagcacagtggcagccctgaggaagatggttgcagaggaaggaggcgtccct
gcagatgaggtgatcttggttgaactgtatcccagtggattccagcggtctttctttgat
gaagaggacctgaataccatcgcagagggagataatgtgtatgcctttcaagttcctccc
tcacccagccaggggactctctcagctcatccactgggtctgtcggcctccccacgcctg
gcagcccgtgagggccagcgattctccctctctctccacagtgagagcaaggtgctaatc
ctcttctgtaacttggtggggtcagggcagcaggctagcaggtttgggccacccttcctg
ataagggaagacagagctgtttcctgggcccagctccagcagtctatcctcagcaaggtc
cgccatcttatgaagagtgaggcccctgtacagaacctggggtctctgttctccatccgt
gttgtgggactctctgtggcctgcagctatttgtctccgaaggacagtcggcccctctgt
cactgggcagttgacagggttttgcatctcaggaggccaggaggccctccacatgtcaag
ctggcggtggagtgggatagctctgtcaaggagcgcctgttcgggagcctccaggaggag
cgagcgcaggatgccgacagtgtgtggcagcagcagcaggcgcatcagcagcacagctgt
accttggatgaatgttttcagttctacaccaaggaggagcagctggcccaggatgacgcc
tggaagtgtcctcactgccaagtcctgcagcaggggatggtgaagctgagtttgtggacg
ctgcctgacatcctcatcatccacctcaaaaggttctgccaggtgggcgagagaagaaac
aagctctccacgctggtgaagtttccgctctctggactcaacatggctccccatgtggcc
cagagaagcaccagccccgaggcaggactgggcccctggccttcctggaagcagccggac
tgcctgcccaccagttacccgctggacttcctgtacgacctgtatgccgtctgcaaccac
cacggcaacctgcaaggtgggcattacacagcctactgccggaactctctggatggccag
tggtacagttatgatgacagcacggtggaaccgcttcgagaggatgaggtcaacaccaga
ggggcttatatcctgttctatcagaagcggaacagcatccctccctggtcagccagcagc
tccatgagaggctctaccagctcctccctgtctgatcactggctcctacggctcgggagc
cacgctggcagcacaaggggaagcctgctgtcctggagctctgccccctgcccctccctg
ccccaggttcctgactctcccatcttcaccaacagcctctgcaatcaggaaaagggaggg
ttggagtccaggcgtttggtacggggcgtgaaaggcagaagcattagcatgaaggcaccc
accacttcccgagccaagcagggaccattcaagaccatgcctctgcggtggtcctttgga
tccaaggagaaaccaccaggtgcctccgtcgagttggtggagtacttggaatccagacga
agacctcggtccacgagccagtccattgtgtcgctgttgacgggcactgcgggtgaggat
gagaagtcagcatcgccgaggtccaacgtcgcccttcttgctaacagcgaagatggtggg
caggccattgaaagaggtccagccggggtgccctgtccctcggctcaacccaaccactgt
ctggcccctggaaactcagatggtccaaacacagcaaggaaactcaaggaaaatgcaggg
caggacatcaagcttcccagaaagtttgacctgcctctcactgtgatgccttcagtggag
catgagaaaccagctcgaccggagggccagaaggccatgaactggaaggagagcttccag
atgggaagcaaaagcagcccaccctccccctatatgggattctctggaaacagcaaagac
agtcgccgaggcacctctgagctagacagacccctgcaggggacactcacccttctgagg
tccgtgtttcggaagaaggagaacaggaggaatgagagggcagaggtctctccacaggtg
ccccccgtctccctggtgagtggcgggctgagccctgccatggacgggcaggctccaggc
tcacctcctgccctcaggatcccagagggcctggccaggggcctgggcagccggctcgag
agggatgtctggtcagcccccagctctctccgcctccctcgtaaagccagcagggccccg
agaggcagtgcactgggcatgtcacaaaggactgttccaggggaacaggcttcttatggc
acctttcagagggtcaaatatcacactctttctttaggtcgaaagaaaaccttaccggag
tccagcttttga

DBGET integrated database retrieval system