KEGG   Pan troglodytes (chimpanzee): 455080Help
Entry
455080            CDS       T01005                                 

Gene name
USP43, WDR16
Definition
(RefSeq) ubiquitin specific peptidase 43
  KO
K11856  
ubiquitin carboxyl-terminal hydrolase 43 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     455080 (USP43)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   455080 (USP43)
Ubiquitin system [BR:ptr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    455080 (USP43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 1118 aa AA seqDB search
MDLGPGDAAGGGLLAPRPRRRRSLRRLFSRFLLALGSRSRPGDSPPRPQPGHCDGDGEGG
FACAPGPVPAAPGSPGEERPPGPQPQLQLPAGDGARPPGAQGLKNHGNTCFMNAVVQCLS
NTDLLAEFLALGRYQAAPGRAEVTEQLAALVRALWTREYTPQLSAEFKNAVSKYGSQFQG
NSQHDALEFLLWLLDRVHEDLEGSSRGPVSEKLPPEATKTSENCLSPSAQLPLGQSFVQS
HFQAQYRSSLTCPHCLKQSNTFDPFLCVSLPIPLRQTRFLSVTLVFPSKSQRFLRVGLAV
PILSTVAALRKMVAEEGGVPADEVILVELYPSGFQRSFFDEEDLNTIAEGDNVYAFQVPP
SPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFL
IREDRAVSWAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKDSRPLC
HWAVDRVLHLRRPGGPPHVKLAVEWDSSVKERLFGSLQEERAQDADSVWQQQQAHQQHSC
TLDECFQFYTKEEQLAQDDAWKCPHCQVLQQGMVKLSLWTLPDILIIHLKRFCQVGERRN
KLSTLVKFPLSGLNMAPHVAQRSTSPEAGLGPWPSWKQPDCLPTSYPLDFLYDLYAVCNH
HGNLQAYCRNSLDGQWYSYDDSTVEPLREDEVNTRGAYILFYQKRNSIPPWSASSSMRGS
TSSSLSDHWLLRLGSHAGSTRGSLLSWSSAPCPSLPQVPDSPIFTNSLCNQEKGGLESRR
LVRGVKGRSISMKAPTTSRAKQGPFKTMPLRWSFGSKEKPPGASVELVEYLESRRRPRST
SQSIVSLLTGTAGEDEKSASPRSNVALLANSEDGGQAIERGPAGVPCPSAQPNHCLAPGN
SDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQMGSKS
SPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNERAEVSPQVPPVSL
VSGGLSPAMDGQAPGSPPALRIPEGLARGLGSRLERDVWSAPSSLRLPRKASRAPRGSAL
GMSQRTVPGEQASYGTFQRVKYHTLSLGRKKTLPESSF
NT seq 3357 nt NT seq  +upstreamnt  +downstreamnt
atggacctgggccccggggacgcggcaggagggggactgctcgcgccccggccccgccgc
cgccgctccctgcgccgcctgttcagccgcttcctgctggcgctgggcagccgctcacgc
cccggggactcaccgccccggccccagccgggacactgtgatggcgacggtgaggggggc
ttcgcctgcgccccgggcccagttccagcggcccccgggagccccggggaggaacgcccg
cccggaccccagccccagctccagctccccgccggcgatggggcgcggccgccgggcgct
cagggcttgaagaaccacggcaacacctgtttcatgaacgcggtggtgcagtgtctcagc
aacaccgacctgctggccgagttcctggcgctggggcgctaccaggcggcgccgggccgc
gccgaggtcaccgagcagctggcggcgctggtgcgcgcgctctggactcgcgaatacacg
ccccaactttccgcggagttcaagaatgcagtttccaagtacggctctcagttccaaggc
aattcccagcacgacgccctggaattcctgctctggttgctggatcgtgtacatgaggac
ctggagggttcatcccgagggccggtgtcggagaagcttccgcctgaagccactaaaacc
tctgagaactgcctgtcaccatcagctcagcttcctctaggtcaaagctttgtgcaaagc
cactttcaagcacaatatagatcttccttgacttgtccccactgcctgaaacagagcaac
acctttgatcctttcctgtgtgtgtccctacctatccccttgcgccagacgaggttcttg
agtgtcaccttggtcttcccctctaagagccagcggttcctgcgggttggcttggccgtg
ccaatcctcagcacagtggcagccctgaggaagatggttgcagaggaaggaggcgtccct
gcagatgaggtgatcttggttgaactgtatcccagtggattccagcggtctttctttgat
gaagaggacctgaataccatcgcagagggagataatgtgtatgcctttcaagttcctccc
tcacccagccaggggactctctcagctcatccactgggtctgtcggcctccccacgcctg
gcagcccgtgagggccagcgattctccctctctctccacagtgagagcaaggtgctaatc
ctcttctgtaacttggtggggtcagggcagcaggctagcaggtttgggccacccttcctg
ataagggaagacagagctgtttcctgggcccagctccagcagtctatcctcagcaaggtc
cgccatcttatgaagagtgaggcccctgtacagaacctggggtctctgttctccatccgt
gttgtgggactctctgtggcctgcagctatttgtctccgaaggacagtcggcccctctgt
cactgggcagttgacagggttttgcatctcaggaggccaggaggccctccacatgtcaag
ctggcggtggagtgggatagctctgtcaaggagcgcctgttcgggagcctccaggaggag
cgagcgcaggatgccgacagtgtgtggcagcagcagcaggcgcatcagcagcacagctgt
accttggatgaatgttttcagttctacaccaaggaggagcagctggcccaggatgacgcc
tggaagtgtcctcactgccaagtcctgcagcaggggatggtgaagctgagtttgtggacg
ctgcctgacatcctcatcatccacctcaaaaggttctgccaggtgggcgagagaagaaac
aagctctccacgctggtgaagtttccgctctctggactcaacatggctccccatgtggcc
cagagaagcaccagccccgaggcaggactgggcccctggccttcctggaagcagccggac
tgcctgcccaccagttacccgctggacttcctgtacgacctgtatgccgtctgcaaccac
cacggcaacctgcaagcctactgccggaactctctggatggccagtggtacagttatgat
gacagcacggtggaaccgcttcgagaggatgaggtcaacaccagaggggcttatatcctg
ttctatcagaagcggaacagcatccctccctggtcagccagcagctccatgagaggctct
accagctcctccctgtctgatcactggctcctacggctcgggagccacgctggcagcaca
aggggaagcctgctgtcctggagctctgccccctgcccctccctgccccaggttcctgac
tctcccatcttcaccaacagcctctgcaatcaggaaaagggagggttggagtccaggcgt
ttggtacggggcgtgaaaggcagaagcattagcatgaaggcacccaccacttcccgagcc
aagcagggaccattcaagaccatgcctctgcggtggtcctttggatccaaggagaaacca
ccaggtgcctccgtcgagttggtggagtacttggaatccagacgaagacctcggtccacg
agccagtccattgtgtcgctgttgacgggcactgcgggtgaggatgagaagtcagcatcg
ccgaggtccaacgtcgcccttcttgctaacagcgaagatggtgggcaggccattgaaaga
ggtccagccggggtgccctgtccctcggctcaacccaaccactgtctggcccctggaaac
tcagatggtccaaacacagcaaggaaactcaaggaaaatgcagggcaggacatcaagctt
cccagaaagtttgacctgcctctcactgtgatgccttcagtggagcatgagaaaccagct
cgaccggagggccagaaggccatgaactggaaggagagcttccagatgggaagcaaaagc
agcccaccctccccctatatgggattctctggaaacagcaaagacagtcgccgaggcacc
tctgagctagacagacccctgcaggggacactcacccttctgaggtccgtgtttcggaag
aaggagaacaggaggaatgagagggcagaggtctctccacaggtgccccccgtctccctg
gtgagtggcgggctgagccctgccatggacgggcaggctccaggctcacctcctgccctc
aggatcccagagggcctggccaggggcctgggcagccggctcgagagggatgtctggtca
gcccccagctctctccgcctccctcgtaaagccagcagggccccgagaggcagtgcactg
ggcatgtcacaaaggactgttccaggggaacaggcttcttatggcacctttcagagggtc
aaatatcacactctttctttaggtcgaaagaaaaccttaccggagtccagcttttga

DBGET integrated database retrieval system