KEGG   Pan troglodytes (chimpanzee): 455108Help
Entry
455108            CDS       T01005                                 

Gene name
MYST2, KAT7
Definition
MYST histone acetyltransferase 2
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     455108 (MYST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 581 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKAPTERQLRYKEKVAELRKK
RNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQI
TEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVW
KHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEAD
NTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERP
LSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKG
KHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaaccgaagattccgatttt
tctacagatctcgagcacacagacagttcagaaagtgatggcacatcccgacgatctgct
cgagtcacccgctcctcagccaggctaagccagagttctcaagattccagtcctgttcga
aatctgcagtcttttggcactgaggagcctgcttactctaccagaagagtgacccgtagt
cagcagcagcctaccccagtgacaccgaaaaaataccctcttcggcagactcgttcatct
ggttcagaaactgagcaagtggttgatttttcagatagagaaactaaaaatacagctgat
catgatgagtcaccgcctcgaactccaactggaaatgcaccttcttctgagtctgacata
gacatctccagccccaatgtgtctcacgacgagagcattgccaaggacatgtccctgaag
gactcaggcagtgatctctctcatcgccccaagcgccgtcgcttccatgaaagctacaac
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacat
gagagacatttctccatctcaggatgcccactctatcataacctctcagctgacgaatgc
aaggcaccaacggagaggcagcttcgatataaggaaaaagtggctgaactcaggaagaaa
agaaattctggactgagcaaagaacagaaagagaaatatatggaacacagacagacctat
gggaacacacgggaacctcttttagaaaacctgacaagcgaatatgacttggatcttttc
cgaagagcacaagcccgggcttcagaggatttggagaagttaaggctgcaaggccaaatc
acagagggaagcaacatgattaaaacaattgcttttggccgctatgagcttgatacctgg
taccattctccatatcctgaagaatatgcacggctgggacgtctctatatgtgtgaattc
tgtttaaaatatatgaagagccaaacgatactccgccggcacatggccaaatgtgtgtgg
aaacacccacctggtgatgagatatatcgcaaaggttcaatctctgtgtttgaagtggat
ggcaagaaaaacaagatctactgccagaacctgtgcctgttggccaaactttttctggac
cacaagacattatattatgatgtggagcccttcctgttctatgttatgacagaggcggac
aacactggctgtcacctgattggatatttttccaaggaaaagaattcattcctcaactac
aacgtctcctgtatccttactatgcctcagtacatgagacagggctatggcaagatgctt
attgatttcagttatttgctttccaaagtcgaagaaaaagttggctccccagaacgtcca
ctctcagatctggggcttataagctatcgcagttactggaaagaagtacttctccgctac
ctgcataatttccaaggcaaagagatttctatcaaagaaatcagtcaggagacggctgtg
aatcctgtggacattgtcagcactctgcaagcccttcagatgctcaagtactggaaggga
aaacacctagttttaaagagacaggacctgattgatgagtggatagccaaagaggccaaa
aggtccaactccaataaaaccatggatcccagctgcttaaaatggacccctcccaagggc
acttaa

DBGET integrated database retrieval system