KEGG   Pan troglodytes (chimpanzee): 455242Help
Entry
455242            CDS       T01005                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    455242 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    455242 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    455242 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    455242 (ALOX12)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     455242 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
17
AA seq 663 aa AA seqDB search
MGRYRIRVATGAWLFSGSYNRVQLWLVGARGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDVFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFGYQFLNGANPML
LRRSTSLPSRLVLPSGMEELRAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
IMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYARDALRLWEIIARYVEGIVH
LFYQRDDVVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcatccgcgtggccaccggggcctggctcttctccgggtcgtacaac
cgcgtgcagctttggctggtcggggcgcgcggggaggcggagctggagctgcagctgcgg
ccggcgcggggcgaggaggaggagtttgatcatgacgttgcagaggacttggggctcctg
cagttcgtgaggctgcgcaagcaccactggctggtggacgacgcgtggttctgcgaccgc
atcacggtgcagggccctggagcctgcgcggaggtggccttcccgtgctaccgctgggtg
cagggtgaggacatcctgagcctgcccgagggcaccgcccgcctgccaggagacaatgct
ttggacgtgttccagaagcatcgagagaaggaactgaaagacagacagcagatctactgc
tgggccacctggaaggaagggttacccctgaccatcgctgcagaccgtaaggatgatcta
cctccaaatatgagattccatgaggagaagaggctggactttgaatggacactgaaggca
ggggctctggagatggccctcaaacgtgtttacaccctcctgagctcctggaactgccta
gaagactttgatcagatcttctggggccagaagagtgccctggctgagaaggttcgccag
tgctggcaggatgatgagttgttcggctaccagttcctcaatggtgccaaccccatgctg
ttgagacgctcgacctctctgccctccaggctagtgctgccctcggggatggaagagctt
cgtgctcaactggagaaagaacttcagaatggttccctgtttgaagctgacttcatcctt
ctggatggaattccagccaacgtgatccgaggagagaagcaatacctggctgcccccctc
attatgctgaagatggagcccaatgggaagctgcagcccatggtcatccagattcagcct
cccaaccccagctctccaaccccaacactgttcctgccctcagaccccccacttgcctgg
ctcctggcaaagtcctgggtccgaaattcagatttccaactgcacgagatccagtatcac
ttactgaacactcatctggtggctgaggtcatcgctgtcgccaccatgcggtgcctccca
ggactgcaccccatcttcaagttcctgatcccccatatccgctacaccatggaaatcaac
acccgggcccggacccaactcatctcagatggaggaatttttgataaggcagtgagcaca
ggtggagggggccatgtacagttgctccgtcgggcggcagctcagctgacctactgctcc
ctctgtcctcctgacgacctggctgaccggggcctgctgggactcccaggtgctctctat
gcccgtgatgctttacggctctgggagatcattgccaggtatgtggaggggatcgtccac
ctcttctaccaaagggatgacgtagtgaagggggaccctgagctgcaggcctggtgtcgg
gagatcacggaggtggggctgtgccaggcccaggaccgaggtttccctgtctcctttcag
tcccagagtcaactctgccatttcctcaccatgtgcgtcttcacgtgcactgcccagcat
gccgccatcaaccagggccagctggactggtatgcctgggtccctaatgctccatgcaca
atgcggatgcccccacccaccaccaaggaagatgtaacgatggccacagtgatggggtca
ctacctgatgtccggcaggcctgtcttcaaatggccatctcatggcatctgagtcgccgc
cagccagacatggtgcctctggggcatcacaaagaaaaatatttctcaggccccaagccc
aaagctgtgctaaaccaattccgaacagatttggaaaagctggaaaaggagattacagcc
cggaatgagcaacttgactggccctatgaatatctgaagcccagctgcatagagaacagt
gtcaccatctga

DBGET integrated database retrieval system