KEGG   Pan troglodytes (chimpanzee): 455243Help
Entry
455243            CDS       T01005                                 

Definition
arachidonate 12-lipoxygenase, epidermal-type-like
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ptr00590]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:ptr04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:ptr04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 669 aa AA seqDB search
MGKYTVRVATGDLLLAGSPNLVQLWLVGEHGEADLGKQLPPVWGKEAEFEIDVHLHLGRL
LMVKLRKHNVLLSLDWFCKWISVQGPGTQGEAFFPCYRWVQGHGIICLPEGTARTVSDDP
QSLFKKYREQELEERRKVYRWGSWKDGLILPIAGNRQPDLPRGERFLEDKDLDFNVSLAK
GLKDLAIQGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPML
LRRSSRLPACLVLKPGKGQLQKQLQPCFLFLPLALXAGSLFEVDFSLLDGVKPNVIIFKQ
QYVAAPLVMLKLQPVGGLLPMVIQLQPPXHGCPPPLLFLPSHPPMAWLLGKTWVRSSDFQ
LQQLQSHLLRGHLIAEVIAVATMRSLPSLHPIYKLLIPHFRYTMAINTLAQSSLVSEWGI
FDLVVSTGSGGHVDILQRAMACLTYHSLCPPDDLADRGLLDVKSTFYGXDAIRLWGIISR
YVEGMVGLFYKSDQAMKDDLELQFWFRDLXFSFHQDSHFTRFLISLESRAQLCHFVTMCI
FTCTGQHASNHLGQLDWCSWIPNGPCTMQKPPPISKDVTEKDIVDLLPNLHQARMQKTFT
KFPGRRQPVMVALGQHEEKYFSGPEPQAVLRQFQEELAAMDKEIEVRNAVLDLPCEYLRP
SMVENSVTI
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacggtccgcgtagccaccggggatttgctcctggcgggctctcccaac
ctggtgcagctgtggctggtgggcgagcacggggaggcagacctagggaagcagctgcca
ccggtgtggggaaaggaggcagagtttgagatcgacgtccacctgcacctggggcgcctc
ctgatggtgaagctgcgcaaacacaacgtgctgttgagtctcgactggttctgcaagtgg
atctcagtgcagggcccggggacccaaggcgaggcctttttcccctgctaccgctgggtg
cagggccacggaattatctgcctgcctgagggtactgcccggacggtgagtgatgacccc
cagagcctgtttaagaaatatcgggaacaggagctcgaggaaagaaggaaggtgtaccgg
tggggctcctggaaagatgggttaatcctgcctatagcagggaataggcaaccggacctt
cctaggggcgagcgattcctcgaggataaggatttagactttaatgtctccctagcaaaa
gggttgaaggacttggccattcaggggacactggatttcataaattgtgtgaaaaggctg
gaagatttcaaaaaaatattcccacatggaaagactgtcctggctgagcgggtttatgat
tcttggaagaatgatgccttctttgggtaccagtttctcaatggtgcaaaccccatgctc
ctgaggcgttcttcaaggctcccggcctgcctggtgctaaagccagggaaagggcaactc
cagaaacaactccaaccctgttttctattcctgcccctggccctgtaggctggatctctg
tttgaagtggacttctccttgctggatggagtcaagcctaatgtcatcatttttaagcag
caatacgtggcagcccctttggtcatgctgaagcttcagcctgttggaggactcttaccc
atggtcatccagctccagccaccttgacacggatgtcccccacctctgctctttctgccc
tcgcatccccccatggcctggctcctgggcaagacctgggtccggagctctgatttccag
ctgcagcagttacagtcacatctgctgaggggacacttgattgctgaggttattgctgtg
gctacaatgagaagcttgcctagcctccatcctatctacaagctcctgatcccccacttc
cgctacaccatggcgatcaacacgctggcccagagtagtcttgtctccgaatggggaatt
tttgacctggtggtgagcactggtagtggaggccacgtggacattcttcagagagccatg
gcttgtttgacctatcattccctctgtcctcctgatgacctggctgaccgtgggctcctg
gatgtgaaatctactttttatggctaagatgccatcaggctgtggggaatcatcagccgg
tacgtggaggggatggttgggcttttctacaagagtgaccaagccatgaaggatgatcta
gagctgcagttctggtttcgagatctctgattctcatttcaccaggattctcatttcacc
aggttcctcatctccttagagtcccgggctcagctctgccactttgtcaccatgtgcatc
ttcacatgcacaggtcagcatgcttctaaccacctgggccagctggactggtgctcctgg
atccctaatggcccatgcactatgcagaagcccccgcccatctctaaggatgtgacagag
aaggatatagtggacttactgcccaatctccaccaggcacgtatgcaaaagaccttcaca
aagttccctggcagacgccagcctgtcatggtggccctggggcagcatgaggagaaatat
ttctctggccctgagccccaagctgtgctgagacaattccaggaggaactggctgccatg
gacaaggagattgaggtccggaatgcagtcctggacctgccctgtgagtaccttcgaccc
agcatggtagagaacagcgtgaccatctga

DBGET integrated database retrieval system