KEGG   Pan troglodytes (chimpanzee): 455243Help
Entry
455243            CDS       T01005                                 

Definition
(RefSeq) arachidonate 12-lipoxygenase, epidermal-type-like
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    455243
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    455243
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    455243
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     455243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 673 aa AA seqDB search
MGKYTVRVATGDLLLAGSPNLVQLWLVGEHGEADLGKQLPPVWGKEAEFEIDVHLHLGRL
LMVKLRKHNVLLSLDWFCKWISVQGPGTQGEAFFPCYRWVQGHGIICLPEGTARTVSDDP
QSLFKKYREQELEERRKVYRWGSWKDGLILPIAGNRQPDLPRGERFLEDKDLDFNVSLAK
GLKDLAIQGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLNGANPML
LRRSSRLPACLVLKPGKEGIQGQLQKQLQPCFLFLPLALXAGSLFEVDFSLLDGVKPNVI
IFKQQYVAAPLVMLKLQPVGGLLPMVIQLQPPXHGCPPPLLFLPSHPPMAWLLGKTWVRS
SDFQLQQLQSHLLRGHLIAEVIAVATMRSLPSLHPIYKLLIPHFRYTMAINTLAQSSLVS
EWGIFDLVVSTGSGGHVDILQRAMACLTYHSLCPPDDLADRGLLDVKSTFYGXDAIRLWG
IISRYVEGMVGLFYKSDQAMKDDLELQFWFRDLXFSFHQDSHFTRFLISLESRAQLCHFV
TMCIFTCTGQHASNHLGQLDWCSWIPNGPCTMQKPPPISKDVTEKDIVDLLPNLHQARMQ
KTFTKFPGRRQPVMVALGQHEEKYFSGPEPQAVLRQFQEELAAMDKEIEVRNAVLDLPCE
YLRPSMVENSVTI
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacggtccgcgtagccaccggggatttgctcctggcgggctctcccaac
ctggtgcagctgtggctggtgggcgagcacggggaggcagacctagggaagcagctgcca
ccggtgtggggaaaggaggcagagtttgagatcgacgtccacctgcacctggggcgcctc
ctgatggtgaagctgcgcaaacacaacgtgctgttgagtctcgactggttctgcaagtgg
atctcagtgcagggcccggggacccaaggcgaggcctttttcccctgctaccgctgggtg
cagggccacggaattatctgcctgcctgagggtactgcccggacggtgagtgatgacccc
cagagcctgtttaagaaatatcgggaacaggagctcgaggaaagaaggaaggtgtaccgg
tggggctcctggaaagatgggttaatcctgcctatagcagggaataggcaaccggacctt
cctaggggcgagcgattcctcgaggataaggatttagactttaatgtctccctagcaaaa
gggttgaaggacttggccattcaggggacactggatttcataaattgtgtgaaaaggctg
gaagatttcaaaaaaatattcccacatggaaagactgtcctggctgagcgggtttatgat
tcttggaagaatgatgccttctttgggtaccagtttctcaatggtgcaaaccccatgctc
ctgaggcgttcttcaaggctcccggcctgcctggtgctaaagccagggaaagaggggata
caagggcaactccagaaacaactccaaccctgttttctattcctgcccctggccctgtag
gctggatctctgtttgaagtggacttctccttgctggatggagtcaagcctaatgtcatc
atttttaagcagcaatacgtggcagcccctttggtcatgctgaagcttcagcctgttgga
ggactcttacccatggtcatccagctccagccaccttgacacggatgtcccccacctctg
ctctttctgccctcgcatccccccatggcctggctcctgggcaagacctgggtccggagc
tctgatttccagctgcagcagttacagtcacatctgctgaggggacacttgattgctgag
gttattgctgtggctacaatgagaagcttgcctagcctccatcctatctacaagctcctg
atcccccacttccgctacaccatggcgatcaacacgctggcccagagtagtcttgtctcc
gaatggggaatttttgacctggtggtgagcactggtagtggaggccacgtggacattctt
cagagagccatggcttgtttgacctatcattccctctgtcctcctgatgacctggctgac
cgtgggctcctggatgtgaaatctactttttatggctaagatgccatcaggctgtgggga
atcatcagccggtacgtggaggggatggttgggcttttctacaagagtgaccaagccatg
aaggatgatctagagctgcagttctggtttcgagatctctgattctcatttcaccaggat
tctcatttcaccaggttcctcatctccttagagtcccgggctcagctctgccactttgtc
accatgtgcatcttcacatgcacaggtcagcatgcttctaaccacctgggccagctggac
tggtgctcctggatccctaatggcccatgcactatgcagaagcccccgcccatctctaag
gatgtgacagagaaggatatagtggacttactgcccaatctccaccaggcacgtatgcaa
aagaccttcacaaagttccctggcagacgccagcctgtcatggtggccctggggcagcat
gaggagaaatatttctctggccctgagccccaagctgtgctgagacaattccaggaggaa
ctggctgccatggacaaggagattgaggtccggaatgcagtcctggacctgccctgtgag
taccttcgacccagcatggtagagaacagcgtgaccatctga

DBGET integrated database retrieval system