KEGG   Pan troglodytes (chimpanzee): 455566Help
Entry
455566            CDS       T01005                                 

Gene name
DOT1L
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00310  Lysine degradation
ptr05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    455566 (DOT1L)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    455566 (DOT1L)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     455566 (DOT1L)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     455566 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 455566
NCBI-ProteinID: XP_016790120
Ensembl: ENSPTRG00000010225
Position
19
AA seq 1684 aa AA seqDB search
MENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQV
YNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVA
AATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIAN
TSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVV
ELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAA
TPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRP
KKMNTANPERKPKKNQTALDALHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNP
LLVAPTPPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNAQLLGAAQQLLS
HCQAQKEEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRG
QSLQLLKARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQ
ELLQLKSCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMN
GQAAGYELCGALSRPPSKQNTPQYLASPLDQEVVPCTPSHVGRPRLEKLSGLAAPDYTRL
SPAKIVLRRHLSQDHTVPGRPAASELHSRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLS
PGALQLAGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRA
ERARSTPSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPA
SLTPGAEPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGG
ATQGPLPEATKGDLPSDSGFSDPESEAKRRIVFTITTGAGSAKQSPSSKHSPLTTSARGD
CVPSHGQDSRKRGRRKRASAGTPSLSAGVSPKRRALPSVAGLFTQPSGSPLNLNSMVSNI
NQPLEITAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDE
PSSARIERKIATISLESKSPPKTLENGGGLAGRKPAPAGEPVNSSKWKSTFSPISDIGLA
KSADSPLQASSALSQNSLFTFRPALEEPSADAKLAAHPRKGFPGSLSGADGLSPGTNPAN
GCTFGGGLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEGSDANPFLSKRQLD
GLAGLKGEGSRGKEAGEGGLPLCGPTDKTPLLSGKAAKARDRELDLKNGHNLFISAAAVP
PGSLLSGPGLAPAASSAGGAASSAQTHRSFLGPFPPGPQFALGPMSLQANLGSVAGSSVL
QSLFSSVPAAAGLVHVSSAATRLTNSHAMGSFSGVAGGTVGGVFNHAVPSASAHPFGARV
GRGAACGSATLGPSPLQAAASASASSFQAPASVETRPPPPPPPPPPPLPPPAHLGRSPAG
PPVLHAPPPPNAALPPPPTLLASNPEPALLQSLASLPPNQAFLPPTSAASLPPANASLSI
KLTSLPHKGARPSFTVHHQPLPRLALAQAAPGIPQASATGPSAVWVSLGMPPPYAAHLSG
VKPR
NT seq 5055 nt NT seq  +upstreamnt  +downstreamnt
atggagaattacgttttaattgactatgacaccaaaagcttcgagagcatgcagaggctc
tgcgacaagtacaaccgtgccattgacagcatccaccagctgtggaagggcaccacgcag
cccatgaagctgaacacgcggccgtccactggactcctgcgccatatcctgcagcaggtc
tacaaccactcggtgaccgaccccgagaagctcaacaactacgagcccttctcccccgag
gtgtacggggagacctccttcgacctggtggcccagatgattgacgagatcaagatgacc
gacgacgacctgtttgtggacttggggagcggtgtgggtcaggtcgtgctccaggttgct
gctgccaccaactgcaaacatcactatggcgtcgagaaagcagacatcccggccaagtat
gcggagaccatggaccgcgagttcaggaagtggatgaaatggtatggaaaaaagcatgca
gaatacacattggagagaggcgatttcctctcagaagagtggagggagcgaatcgccaac
acgagtgttatatttgtgaataattttgcctttggtcctgaggtggatcaccagctgaag
gagcggtttgcaaacatgaaggaaggtggcagaatcgtgtcctcgaaaccctttgcacct
ctgaacttcagaataaacagtagaaacttgagtgacatcggcaccatcatgcgcgtggtg
gagctctcgcccctgaagggctcggtgtcgtggacggggaagccagtctcctactacctg
cacactatcgaccgcaccatacttgaaaactatttttctagtctgaaaaacccaaaactc
agggaggaacaggaggcagcccggcgccgccagcagcgcgagagcaagagtaacgcggcc
acgcccactaagggcccagagggcaaggtggccggccccgccgacgcccccatggactct
ggtgctgaggaagagaaggcgggagcagccaccgtgaagaagccgtctccctccaaagcc
cgcaagaagaagctaaacaagaaggggaggaagatggctggccgcaagcgcgggcgcccc
aagaagatgaacactgcgaaccccgagcggaagcccaagaagaaccaaactgcactggat
gccctgcacgctcagaccgtgtctcagacggcggcctcctcaccccaggatgcctacaga
tcccctcacagcccgttctaccagctacctccgagcgtgcagcggcactcccccaacccg
ctgctggtggcgcccaccccgcccgcgctgcagaagctgctagagtccttcaagatccag
tacctgcagttcctggcatacacaaagaccccccagtacaaggccagcctgcaggagctg
ctgggccaggagaaggagaagaacgcccagctcctgggtgcggctcagcagctcctcagc
cactgccaggcccagaaggaggagatcaggaggctgttccagcaaaaattggatgagctg
ggtgtgaaggcgctgacctacaatgacctgattcaagcgcagaaggagatctccgcccat
aaccagcagctgcgggagcagtcggagcagctggagcaggacaaccgcgcgctccgcggc
cagagcttgcagctgctcaaggctcgctgcgaggagctgcagctggactgggccacgctg
tcgctggagaagctgttgaaggagaagcaggccctgaagagccagatctcggagaagcag
aggcactgcctggagctgcagatcagcattgtggagctagagaagagccagcggcagcag
gagctcctgcagctcaagtcctgtgtgccgcctgacgatgccctgtccctgcacctgcgt
gggaagggcgccctgggccgcgagctggagcctgacgccagccggctgcacctggagctg
gactgcaccaagttctcgctgcctcacttgagcagcatgagcccggagctctccatgaac
ggccaggctgctggctatgagctctgcggtgcgctgagccggcctccgtcgaagcagaac
acgccccagtacctggcctcacccctggaccaggaggtggtgccctgtacccctagccac
gtcggccggccgcgcctggagaagctgtctggcctagccgcacccgactacactaggctg
tccccggccaagattgtgctgaggcggcacctgagccaggaccacacggtgcccggcagg
ccggccgccagtgagctgcattcgagagctgagcacaccaaggagaacggccttccctac
cagagccccagcgtgcctggcagcatgaagctgagccctcaggacccgcggcccctgtcc
cctggggccttgcagcttgctggagagaagagcagtgagaagggcctgagagagcgcgcc
tatggcagcagcggggagctcatcaccagcctgcccatcagcatcccgctcagcaccgtg
cagcccaacaagctcccggtcagcattcccctggccagcgtggtgctgcccagccgcgcc
gagagggcgaggagcacccccagtcccgtgctgcagccccgtgacccctcgtccacactt
gaaaagcagattggtgctaatgcccacggtgctgggagcagaagccttgccctggccccc
gcaggcttctcctacgctggctcggtggccatcagcggggccttggcgggcagcccggcc
tctctcacacctggagccgagccggccaccttggatgagtcctccagctctgggagcctt
tttgccacggtggggtcccgcagctccacgccacagcaccccctgctgctggcacagccc
cggaactcgcttcctgcctctcccgcccaccagctctcctccagtccccggcttggtggg
gccacacagggcccgctgcccgaggccaccaagggggacctgccctccgattccggcttc
tcagatcctgagagtgaagccaagaggaggattgtgttcaccatcaccactggtgcgggc
agtgccaagcagtcgccctccagcaagcacagccccctgaccaccagcgcccgtggggac
tgtgtgccgagccacgggcaggacagccgcaagcgcggccggcggaagcgagcatctgcg
gggacgcccagcttgagcgcaggcgtgtcccccaagcgccgagccctgccgtccgtcgct
ggccttttcacacagccttcggggtctcccctcaacctcaactccatggtcagtaacatc
aaccagcccctggagattacagccatctcgtccccggagacctccctgaagagctcccct
gtgccctaccaggaccacgaccagccccccgtgctcaagaaggagcggcctctgagccag
accaatggggcacactactccccactcacctcagacgaggagccaggctctgaggacgag
cccagcagtgctcgaattgagagaaaaattgcaacaatctccttagaaagcaaatctccc
ccgaaaaccttggaaaacggtggtggcttggcgggaaggaagcccgcgcccgccggcgag
ccagtcaatagcagcaagtggaagtccaccttctcgcccatctccgacatcggcctggcc
aagtcggcggacagcccgctgcaggccagctccgccctcagccagaactccctgttcacg
ttccggcccgccctggaggagccctctgccgatgccaagctggccgctcaccccaggaaa
ggctttcccggctccctgtcgggggctgatggactcagcccgggcaccaaccctgccaac
ggctgcaccttcggcgggggcctggccgcggacctgagtttacacagcttcagtgatggt
gcttctcttccccacaagggccccgaggcggccggcctgagctccccgctgagcttcccc
tcgcagcgcggcaaggagggctcggacgccaaccctttcctgagcaagaggcagctggac
ggcctggctgggctgaagggcgagggcagccgcggcaaggaggcaggggagggcggccta
ccgctgtgcgggcccacggacaagaccccactgctgagcggcaaggccgccaaggcccgg
gaccgcgagctcgacctcaagaatggccacaacctcttcatctctgcggcggccgtgcct
cccggaagcctcctcagcggccccggcctggccccggcggcgtcgtccgcaggcggcgcg
gcgtcctccgcccagacgcaccggtccttcctgggccccttcccgccggggccgcagttc
gcgctcggccccatgtccctgcaggccaacctcggctccgtggccggctcctccgtgctg
cagtcgctgttcagctctgtgccggccgccgcaggcctggtgcacgtgtcgtccgctgcc
accagactgaccaactcgcacgccatgggcagcttttccggggtggcaggcggcacagtt
ggaggtgtctttaaccacgcggtgccttccgcctctgctcatccgtttggagcccgtgtc
ggccgcggggctgcatgtggcagcgccacactgggcccgagcccgctgcaggcggcggcc
agcgcctcggcctcttcctttcaggccccggcctcggttgagacccggccgcccccgccg
cctccgcctccgcctcccccgctgcccccgcctgcgcacctgggccggtcccccgcgggg
ccgcccgtcctccacgccccccctccacctaacgccgccttgcctcctcccccaacgctg
ctggcctctaaccctgagcccgcgcttctgcagagcctcgcgtccctcccgcctaaccaa
gctttcttgccccccacctctgctgcctctctgccgcctgctaacgcctctttgtctatc
aagctcacctccctcccgcacaagggcgcccgcccctccttcacggtgcaccaccagccc
ctgccccggctggccctggcccaggccgcgcccgggatcccacaggccagcgccacgggg
ccgtccgcggtgtgggtgtccctcggcatgccgcctccctatgccgcgcacctttcgggg
gttaagccgcgataa

DBGET integrated database retrieval system