KEGG   Pan troglodytes (chimpanzee): 455659Help
Entry
455659            CDS       T01005                                 

Gene name
PNPLA6
Definition
(RefSeq) patatin like phospholipase domain containing 6
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    455659 (PNPLA6)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     455659 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 1365 aa AA seqDB search
MGTSSHGLATNSSGAKVAERDGFQDVLAPGEGSAGRICGAQPVPFVPQVLGVMIGAGVAV
VVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDTSVST
TSRPRMRKKLKMLNIAKKILRIQKETPTLQRKEPPPAVLEADLTEGDLANSHLPSEVLYM
LKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLLELCLPGPDG
KECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYP
ESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTRTSPVRGSKR
MVSTSATDEPRETPGRPPDPTGAPLPGPTGDPVKPTSLETPSAPLLSRCVSMPGDISGLQ
GGPRSDFDMAYERGRISVSLQEEASGGSLAAPARTPTQEPREQPAGACEYSYCEDESATG
GCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSL
HFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISK
SDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYIV
LNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTLG
HIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPGSGLGVPPHSELTNPASNLATVAILPV
CAEVPMVAFTLELQHALQAIGPTLLLNSDIIRARLGASALDSIQEFRLSGWLAQQEDAHR
IVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRALKQLVLLHRE
EGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRRADRHSDFSRL
ARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSAS
RTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIEDLWLPYFNVT
TDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPADIARSMG
AKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQSRLAYVSCVR
QLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRGNVIEKMLTDR
RSTDLNESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGP
DCSRDEGGSPEGASPSTASEMEEEKSILRQRRCLPQELPGSATDA
NT seq 4098 nt NT seq  +upstreamnt  +downstreamnt
atggggacatcgagtcacgggctggctacgaactcctcgggggcgaaggtggcggagagg
gatgggttccaggacgtcctggcgcccggggaaggctcggcgggacggatttgcggtgcg
cagccagtgccgttcgtccctcaggtgctgggcgtgatgatcggggccggagtggcggtg
gtggtcacggccgtgctcatcctcctggtggtgcggaggctgcgagtgccaaaaacccca
gccccggatggcccccggtatcggttccggaagagggacaaagtgctcttctatggccgg
aagattatgcggaaggtgtcacaatccacctcctccctcgtggatacctctgtctccacc
acttcccggccacgcatgaggaagaaactgaagatgctcaacattgccaagaagatcctg
cgcatccagaaagagacgcccacgctgcagcggaaggagcccccgcccgcagtgctagaa
gctgacctgaccgagggcgacctggctaactcccatctgccctccgaagtgctttatatg
ctcaagaacgtccgggtgctgggccacttcgagaagccactcttcctggagctctgccgc
cacatggtcttccagcggctgggccagggtgactacgttttccggccgggccagccagat
gccagcatctacgtggtgcaggacgggctgctggagctctgcctgccagggcctgacggg
aaggagtgtgtggtgaaggaagtggttcctggggacagcgtcaacagccttctcagcatc
ctggatgtcatcaccggtcaccagcatccccagcggaccgtgtctgcccgggcggcccgg
gactccacggtgctgcgcctgccggtggaagcattctccgcggtcttcaccaagtacccg
gagagcttggtgcgggtcgtgcagatcatcatggtgcggctgcagcgagtcaccttcctg
gcactgcacaactacctgggtctgaccaatgagctcttcagccacgagatccagcccctg
cgtctgttccccagccctggcctcccaactcgcaccagccctgtgcggggctccaagaga
atggtcagcacctcagctacggacgagcccagggagaccccaggccggccacccgatccc
accggggccccgctgcctggacctacaggggaccctgtgaagcccacatccctggaaacc
ccctcggcccctctgctgagccgctgcgtctccatgccaggggacatctcaggcttgcag
ggtggcccccgctccgacttcgacatggcctatgagcgtggccggatctccgtgtccctg
caggaagaggcctccggggggtccctggcagcccccgctcggacccccactcaggagcct
cgtgagcagccggcaggcgcctgtgaatacagctactgtgaggatgagtcggccactggt
ggctgccctttcgggccctaccagggccgccagaccagcagcatcttcgaggcagcaaag
caggagctggccaagctgatgcggattgaggacccctccctcctgaacagccgagtcttg
ctgcaccacgccaaagccggcaccatcattgcccgccagggagaccaggacgtgagcctg
cacttcgtgctctggggctgcctgcacgtgtaccagcgcatgatcgacaaggcggaggac
gtgtgcctgttcgtagcgcagccgggggaactggtggggcagctggcggtgctcactggc
gaacctctcatcttcacactgcgagcccaacgcgactgcaccttcctgcggatctccaag
tccgacttctatgagatcatgcgcgcacagcccagtgtggtgctgagtgcggcgcacacg
gtggcagccaggatgtcgcccttcgtgcgccagatggacttcgccatcgactggactgca
gtggaggcgggacgcgcgctgtacaggcagggcgaccgctccgactgcacttacatcgtg
ctcaatgggcggctgcgtagcgtgatccagcgaggcagtggcaagaaggagctggtgggc
gagtacggccgcggcgacctcatcggcgtggtggaggcactgacccggcagccgcgagcc
acgacggtgcacgcggtgcgcgacacggagctggccaagcttcccgagggcaccttgggt
cacatcaaacgccggtacccgcaggtcgtgacccgccttatccacctactgagccagaaa
attctagggaatttgcagcagctgcaaggacccttcccaggctctgggctgggtgtgccc
ccacactcggaactcaccaacccagccagcaacctggcaactgtggcaatcctgcctgtg
tgtgctgaggtccccatggtggccttcacgctggagctgcagcacgccctgcaggccatc
ggtccgacgctactccttaacagtgacatcatccgggcacgcctgggggcctctgcactg
gatagcatccaagagttccggctgtcagggtggctggcccagcaggaagatgcacaccgt
atcgtactctaccagacggacgcctcgctgacgccctggaccgtgcgctgcttgcgacag
gccgactgcatcctcattgtgggcctgggggaccaggagcctaccctcggccagctggag
cagatgctggagaacacggctgtgcgcgcccttaagcagctagtcctgctccaccgagag
gagggcgcgggccccacgcgcaccgtggagtggctaaatatgcgcagctggtgctcgggg
cacctgcacctgcgctgtccgcgccgcctcttttcgcgccgcagccctgccaagctgcat
gagctctacgagaaggttttctccaggcgtgcggaccggcacagcgacttctcccgcttg
gcgagggtgctcacggggaacaccattgcccttgtgctaggcgggggcggggccaggggc
tgctcgcacatcggagtactaaaggcattagaggaggcgggggtccccgtggacctggtg
ggcggcacgtccattggctctttcatcggagcgctgtacgcggaggagcgcagcgccagc
cgcacgaagcagcgggcccgggagtgggccaagagcatgacttcggtgctggaacctgtg
ttggacctcacgtacccagtcacctccatgttcactgggtctgcctttaaccgcagcatc
catcgggtcttccaggataagcagattgaggacctgtggctgccttacttcaacgtgacc
acagatatcaccgcctcagccatgcgagtccacaaagatggctccctgtggcggtatgtg
cgcgccagcatgacgctgtcgggctacctgcccccgctgtgcgaccccaaggacgggcac
ctactcatggatggcggctacatcaacaatctgccagcggacatcgcccgcagcatgggt
gccaaaacggtcatcgccattgacgtggggagccaggatgagacggacctcagcacctac
ggggacagcctgtccggctggtggctgctgtggaagcggctgaatccctgggcggacaag
gtaaaggttccagacatggctgaaatccagtcccgcctggcctacgtgtcctgcgtgcgg
cagctagaggttgtcaagtccagctcctactgcgagtacctgcgcccgcccatcgactgc
ttcaagaccatggactttgggaagttcgaccagatctatgatgtgggctaccagtacggg
aaggcggtgtttggaggctggagccgtggcaacgtcattgagaaaatgctcacagaccgg
cggtctacagaccttaatgagagccgccgtgcagacgtgcttgccttcccaagctctggc
ttcactgacttggcagagattgtgtcccggattgagccccccacgagctatgtctctgat
ggctgtgctgacggagaggagtcagattgtctgacagagtatgaggaggatgccggaccc
gactgctcgagggatgaaggggggtcccccgagggtgcaagccccagcactgcctccgag
atggaggaggagaagtcgattctccggcaacgacgctgtctgccccaggagctgcccggc
tcagccacagatgcctga

DBGET integrated database retrieval system