KEGG   Pan troglodytes (chimpanzee): 455959Help
Entry
455959            CDS       T01005                                 

Gene name
KMT2B
Definition
(RefSeq) lysine methyltransferase 2B
  KO
K14959  
histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    455959 (KMT2B)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     455959 (KMT2B)
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    455959 (KMT2B)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     455959 (KMT2B)
   HMT complexes
    MLL3/MLL4 complex
     455959 (KMT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 2714 aa AA seqDB search
MAAAAGGGSCPGPGSARGRFPGRPRGAGGGGGRGGRGNGAERVRVALRRGGGATGPGGAE
PGEDTALLRLLGLRRGLRRLRRMWAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDE
EEFQGFHSDEDVAPSSLRSALRSQRGRAPRGRGRKHKTTPLPPPRLADVAPTPPKTPARK
RGEEGTERMVQALTELLRRAQAPQAPRSRACEPSTPRRSRGRPPGRPAGPCRRKQQAVVV
AEAAVTIPKPEPPPPVVPVKHQTGSWKCKEGPGPGPGTPRRGGQSSRGGRGGRGRGRGGG
LPFVIKFVSRAKKVKMGQLSLGLESGQGQHEESWQDAPQRRVGSGQGGSPCWKKQEQKLD
DEEEEKKEEEEKDKEEGEEKEERAVAEEMMPAAEKEEAKLPPPPLTPPAPSPPPPLPPPS
TSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPPPVVPATCSRKRGRPPLTPSQRAE
REAARAGPEGTSPPTPTPSTATGGPPEDSPTMAPKSTTFLKNIRQFIMPVVSARSSRVIK
TPRRFMDEDPPKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPHAPTPPSTPVPLPEKRR
SILREPTFRWTSLTRELPPPPPAPPPPPAPSPPPAPATSSRRPLLLRAPQFTPSEAHLKI
YESVLTPPPLGAPEAPEPEPPPADDSPAEPEPRAVGRTNHLSLPRFAPVVTTPVKAEVSP
HGAPALSNGPQTQAQLLQPLQALQTQLLPQALPPPQPQLQPPPSPQQMPPLEKARIAGVG
SLPLSGVEEKMFSLLKRAKVQLFKIDQQQQQKVAASMPLSPGGQMEEVAGAVKQISDRGP
VRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDR
QDLATEDTSSASETESVPSRSRRGKVEAAGTGGESEPTGSGGTLAHTPRRSLPSHHGKKM
RMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKGR
TIVKTLLPWDSDESPEASPGPPGPRRGAGAGGPREEVVAPPGPEEQDSLLQRKSARRCVK
QRPSYDIFEDSDDSEPGGPPAPRRRTPRENELPLPEPEEQSRPRKPTLQPVLQLKARRRL
DKDALAPGPFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSVPGGPP
MVCLLCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGRG
SKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGATPGKNWDVEWSGD
YSLCPRCTQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSG
LPDSVLYTCGPCAGAAQPRWREALSGALQGGLRQVLQGLLSSKVVGPLLLCTQCGPDGKQ
LHPGPCGLQAVSQRFEDGHYKSVHSFMEDMVGILMRHSEEGETPERRAGGQMKGLLLKLL
ESAFGWFDAHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQEPETPELGQPPGDPS
AAFQGKDPAAFSHLEDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEE
NDGSLKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQDDKKVF
CQKHTDLLDGKEIVNPDGFDVLRRVYVDFEGINFKRKFLTGLEPDAINVLIGSIRIDSLG
TLSDLSDCEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPAHLEAAEEN
QTIVHSPAPSSEPPGGEDPPLDTDVLVPGAPEHHSPIQNLDPPLRPDSGSAPPPAPRSFS
GARIKVPNYSPSRRPLGGVSFGPLPSPGSPSSLTHHIPTVGDPDFPAPPRRSRRPSPLAP
RPPPSRWASPPLKTSPQLRVPPPTSVITALTPTSGELAPPGPAPSPPPSEDLGPDFEDME
VVSGLSAADLDFAASLLGTEPFQEEIVAAGAMGSSHGGPGDSSEEESSPTSRYIHFPVTV
VSAPGLAPSATPGAPRIEQLDGVDDGTDSEAEAVQQPRGQGTPPSGPGVVRAGVLGAAGD
RARPPEDLPSEIVDFVLKNLGGPGDGGAGPREESLPPAPPLANGSQPSQGLTASPADPTR
TFAWLPGAPGVRVLSLGPAPEPPKPATSKIILVNKLGQVFVKMAGEGEPVPPPVKQPPLP
PTISPTAPTSWTLPPGPLLGVLPVVGVVRPAPPPPPPPLTLVLSSGPASPPRQAIRVKRV
STFSGRSPPAPPPYKAPRLDEDGEASEDTPQVPGLGSGGFSRVRMKTPTVRGVLDLDRPG
EPAGEESPGLLQERSPLLPLPEGGPPQVPDGPPDLLLESQWHHYSGEASSSEEEPPSPDD
KENQAPKRTGPHLRFEISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSG
ARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTF
DMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYR
SAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDA
TMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKL
PCNCGAKRCRRFLN
NT seq 8145 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcggcggcagttgccccgggcctggctccgcgcggggccgcttc
ccgggccggccgcggggcgccggcgggggcgggggccgcggcggacggggcaacggggcc
gaaagagtgcgggtagctctgcggcgcggcggtggcgcgacggggccgggcggagccgag
cccggggaggacacggccctgctccgtttgctggggctccgccggggcctgcgccggctc
cgccgcatgtgggccggcccgcgggtccagcggggccggggccggggtcggggccggggc
tggggcccgagtcgaggctgcgtgccggaggaggagagcagtgacggggaatccgacgag
gaggagtttcagggttttcattcagatgaagatgtggcccccagttccctgcgctctgcg
ctccgatcccagcgaggtcgagcgccccgaggtcggggtcgcaagcataagacgaccccc
cttcctcctcctcgcctagcagatgtggctcctacccccccaaagacccctgcccggaaa
cggggtgaggaaggcacagaacggatggtgcaggcactgactgaacttctccggcgggcc
caggcaccccaagcaccccggagccgggcatgtgagccctccaccccccggcggtctcgg
ggacggcccccaggacggccagcaggcccctgcaggaggaagcagcaagcagtagtggtg
gcagaagcagctgtgacaatccccaaacctgagcccccacctcctgtggttccagtgaaa
catcagactggcagctggaaatgcaaggaggggcccggtccaggacctgggacccccagg
cgtggaggacagtcaagccgtggaggccgtggaggcaggggccgcggccgaggtggtggg
ctcccctttgtgatcaagtttgtttcaagggccaaaaaagtaaagatgggacaattgtcc
ttgggactcgaatcaggtcaaggtcaacatgaggaaagttggcaggatgccccccaaaga
agagttggatctggacagggagggagcccttgctggaaaaagcaggaacagaagctggat
gacgaggaagaagagaagaaagaagaagaagaaaaagacaaggaggagggagaagagaag
gaagaaagagctgtagcagaggagatgatgccagctgcggaaaaggaagaggcaaagctg
ccaccaccgcctctgactcctccagccccttcacctcctccacccctcccacccccttcg
acatctcctccacccccactctgccctccaccaccacccccagtgtccccaccacctcta
ccatcccctccaccgcctcctgcccaagaggagcaggaagaatcccctcctcctgtggtc
ccagctacgtgctccaggaagaggggccggcctcccctgactcccagccagcgggcggag
cgggaagctgctcgggcagggccagagggcacctctcctcccactccaacccccagcacc
gccacgggaggccctccggaagacagtcccaccatggcccccaaaagcaccaccttcctg
aagaatatccggcagtttattatgcctgtggtgagtgcccgctcctcccgtgtcatcaag
acaccccggcgatttatggatgaagacccccccaaacccccaaaggtggaggtctcacct
gtcctgcgacctcccattaccacctccccacctgttccccaggagccagcaccagtcccc
tctccaccacatgccccaactcctccatctaccccagttccactccctgagaagagacgg
tccatcctaagggaacccacatttcgctggacctcactgacccgggagctgccccctcct
cccccagcccctccacctcccccggccccctccccaccccctgctcctgccacctcctcc
cggaggcccctactccttcgggcccctcagtttaccccaagcgaagcccacctgaagatc
tacgaatcggtgcttactcctcctcctcttggggctcctgaagcccctgagccagagcct
cctcctgccgatgactctccagctgagcctgagcctcgggcagtgggccgcaccaaccac
ctcagcctgcctcgattcgcccctgtggtcaccactcctgttaaggccgaggtgtcccct
cacggggctccagctctgagcaacgggccacagacacaggctcagctactgcagcccctg
caggccttgcaaacccagctcctgccccaggcactaccgccaccacagccacagctgcag
ccaccgccgtcaccacagcagatgcctcccctggaaaaagcccggattgcgggcgtgggt
tccttgccgctgtctggggtagaggagaagatgttcagcctcctcaagagagccaaagtg
cagctattcaagatcgatcagcagcagcagcagaaggtggcagcttccatgccgctgagc
cctggagggcagatggaggaggtggccggggctgtcaagcagatctccgacagaggccct
gtccggtctgaagatgagtcggtggaagctaagagagagcggccctcaggtcccgagtcc
cctgtgcaaggtccccgcatcaaacatgtctgccgtcatgctgctgtggccctgggtcag
gcccgggccatggtgcctgaagatgtccctcgcctcagtgccctccctctccgggatcgg
caggacctcgccacagaggatacatcatcggcgtccgagactgagagtgtcccgtcacgg
tcccggcggggaaaggtggaggcagcaggcactgggggagaatcagagcccacaggttct
ggagggaccctggcccacacaccccggcgctcactgccctcccatcacggcaagaagatg
cgcatggctcgatgtggacactgtcggggctgcctacgtgtgcaggactgtgggtcctgt
gtcaactgcctagacaagcccaagtttgggggccctaacaccaagaagcagtgctgtgta
taccggaagtgtgacaaaatagaggctcggaagatggaacgactggctaaaaaaggccgg
acgatagtgaagacgctgttgccctgggattccgatgaatctcctgaggcctcccctggt
cctccaggcccacgccggggggcgggagctggggggccccgggaggaggtggtggccccc
ccagggcccgaggagcaggactccctcctgcagcgcaagtcagctcggcgctgcgtcaaa
cagcgaccctcctatgatatcttcgaggattcggatgactcggagcccgggggcccccct
gctcctcggcgtcggaccccccgagaaaatgagctgccactgccagaacctgaggagcag
agccggccccgcaaacccaccctgcagcctgtgttgcagctcaaggcccgaaggcgcctg
gacaaggatgctttggcccctggcccctttgcttcttttcccaatggctggactggaaag
cagaagtctcccgatggtgtgcaccgcgtccgtgtggattttaaggaggattgtgattta
gagaacgtgtggctgatggggggcctgagtgtgctcacctctgtgccagggggccccccg
atggtgtgcttgctgtgtgccagcaaaggactccacgagctggtgttctgtcaagtctgc
tgtgacccattccacccattctgcctggaggaggctgagcggcccctgccccagcatcac
gacacctggtgctgccgtcgctgcaaattctgccacgtctgtggacgcaaaggtcgtgga
tccaagcacctcctggagtgcgagcgctgccgccatgcataccacccggcctgtctgggg
cccagctatccaacccgggccacgcgcaaacggcgccactggatctgttcagcctgtgtg
cgctgtaagagctgtggggcaactccaggcaagaactgggacgtcgagtggtctggagat
tacagcctctgccccaggtgcacccagctatatgagaaaggaaactactgcccgatctgt
acacgctgctatgaagacaacgactatgagagcaagatgatgcagtgcgcacagtgcgat
cactgggtgcatgccaagtgcgaggggctctcagatgaagactacgagatcctttcagga
ctgccagactcggtgctgtacacctgcggaccgtgtgctggggcagcgcagccccgctgg
cgagaggccctgagcggggccctccaggggggcctgcgccaggtgctccagggcctgctg
agctccaaggtggtgggcccactgctgctctgcacccagtgtgggccagatgggaagcaa
ctgcacccaggaccctgcggcctgcaagctgtgagtcagcgcttcgaggatggccactac
aagtctgtgcacagcttcatggaggacatggtgggcatcctcatgcggcactcggaggag
ggagagactccggagcgccgggctggaggccagatgaaggggctcctgctgaagctgcta
gaatctgcgttcggctggttcgacgcccacgaccccaagtactggcgacggagtacccgg
ctgccaaacggagtccttcccaatgcggtgttgcccccatccctggatcatgtctatgcg
cagtggagacagcaggaaccagagaccccagaattagggcagcctccaggggatccctca
gcagcattccagggcaaggatccagctgccttctcacacctggaggacccccgtcagtgc
gcactctgcctcaaatacggggatgcagactccaaggaggcggggcggctcttgtacatc
gggcagaacgagtggacacacgtcaactgtgccatctggtcggcggaagtctttgaggag
aacgacggctccctcaagaatgtgcatgctgctgtggcccgagggaggcagatgcgctgc
gagctctgcctgaagcctggcgccacggtgggctgctgcctgtcctcctgcctcagcaac
ttccacttcatgtgtgcccgggccagctactgcatcttccaggatgacaagaaagtcttc
tgccagaaacacactgatctcctggatggcaaggaaattgtgaaccccgatggttttgat
gttctccgccgagtctatgtggacttcgagggcatcaacttcaagcggaagttcttgacg
gggcttgaacccgatgccatcaacgtgctcattggttccatccgcattgactctctgggt
actctgtctgatctctcggactgcgagggacggctcttccccattggctaccagtgctcc
cgtctgtactggagcacagtggatgctcggaggcgctgctggtatcggtgccgaattctg
gagtatcggccatgggggccgagggaagagccagctcacctggaggctgcagaggagaac
cagaccattgtgcacagccccgccccttcctcagagcccccaggtggtgaggacccccca
ctggacacagatgttcttgtccctggagctcctgagcaccactcgcccattcagaacctg
gaccctccactgcggccagattcaggcagcgcccctcccccagccccccgttctttttcg
ggggctcgaatcaaagtgcccaactactcgccatcccggaggcccttggggggtgtctcc
tttggccccctgccctcccctggaagtccatcttcactgacccaccacatccccacagtg
ggagacccggacttcccagctccccccagacgttcccgtcgtcccagccctttggctccc
aggccgcctccatcacggtgggcctcccctcctctaaaaacctcccctcagctcagggtg
ccccctcctacctcagtcatcacagccctcacacctacctcaggggagctggctccccct
ggcccggccccatcaccaccaccctctgaagacctgggcccagacttcgaggacatggag
gtggtgtcaggactgagtgctgctgacctggacttcgcggccagcctgctggggactgag
cccttccaggaagagattgtagccgctggggccatggggagcagccacgggggcccgggg
gacagctccgaggaggagtccagccccacctcccgctacatccacttccctgtgactgtg
gtgtccgcccctggtctggcccccagcgctacccctggagccccccgcattgaacagctg
gacggcgtggacgacggcactgacagtgaggctgaggcggtgcagcagcctcggggccag
ggcactcctccttcggggccaggagtagtccgggcaggggtccttggggctgcaggggac
agggcccggcctcctgaggacctgccatcggaaattgtggattttgtgttgaagaaccta
gggggtcctggggatggaggtgctggccctagagaggagtcactccccccggcgcctccc
ctggctaatggcagccagccctcccaaggcctgaccgccagcccagctgaccccacccgc
acatttgcctggctcccaggggccccaggggtccgggtgttaagccttggccctgcccct
gagccccccaaacccgccacatccaaaatcatacttgtcaacaagctggggcaagtattt
gtgaagatggctggggagggtgaacctgtcccacccccagtgaagcagccacctttgccc
cccaccatttcccccacggctcccacctcctggactctgcccccaggccccctcctcggc
gtgctgcccgtggtcggagtggtccgccctgccccgcccccgccaccccctcccctgacg
ctggtgctgagcagtgggccagccagcccgccccgccaggccatccgcgtcaagagggtg
tccactttctccggccggtccccgccagcacctcccccatacaaagccccccggctggat
gaagatggagaggcctcagaggatacccctcaggttccagggcttggcagtggcgggttt
agccgtgtgaggatgaaaacccccacagtgcgtggggtccttgacctggatcggcctggg
gagcccgctggggaagaaagtcctgggctcctccaggaacggtcccctttgctgccactt
ccggaaggtggtcctccccaggtccccgatggtcccccagacctgctgcttgagtcccag
tggcaccactattcaggtgaggcttcgagctctgaggaagagcctccatccccagacgat
aaagagaaccaggccccaaaacggactggcccacatctgcgcttcgagatcagcagtgag
gatgggttcagcgttgaggcagagagcttggagggggcgtggagaactctgatcgagaaa
gtgcaagaggcccgagggcatgcccgactcagacatctctcctttagtggaatgagtggg
gcgagactcctgggcatccaccatgatgctgtcatcttcctggccgagcagctccccgga
gcccagcgttgccagcactataagttccgttaccaccagcagggagagggccaggaggag
ccgcccctgaatccccatggggctgctcgggcagaggtctatctccggaagtgcaccttt
gacatgttcaacttcctggcctcccagcaccgggtgctccctgagggggccacctgtgat
gaggaagaggatgaggtgcagctcaggtcaaccagacgtgccaccagcctggagctgccc
atggccatgcgttttcgtcaccttaagaagacgtccaaagaagctgtgggtgtctacaga
tcagccatccacgggcgaggcctgttctgtaagcgcaacatcgacgcgggggagatggtc
atcgagtactctggcattgtcatccgctcggtgttgactgacaagcgggagaagttctac
gatgggaagggcatcgggtgctatatgttccgcatggatgactttgatgtagtggacgcc
acgatgcatggcaatgccgcccgcttcatcaaccactcctgtgagcccaactgcttctct
cgggtcatccacgtggagggccagaaacacattgttatcttcgccctgcgccgcatcctg
cgtggtgaggagctcacctacgactacaagttccccatcgaggatgccagcaacaagctg
ccctgcaactgtggcgccaagcgctgccgtcggttccttaactga

DBGET integrated database retrieval system