KEGG   Pan troglodytes (chimpanzee): 455959Help
Entry
455959            CDS       T01005                                 

Definition
histone-lysine N-methyltransferase MLL4-like
Orthology
K14959  
histone-lysine N-methyltransferase MLL4 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ptr00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 2526 aa AA seqDB search
MVQALTELLRRAQAPQAPRSRACEPSTPRRSRGRPPGRPAGPCRRKQQAVVVAEAAVTIP
KPEPPPPVVPVKHQTGSWKCKEGPGPGPGTPRRGGQSSRGGRGGRGRGRGGGLPFVIKFV
SRAKKVKMGQLSLGLESGQGQHEESWQDAPQRRVGSGQGGSPCWKKQEQKLDDEEEEKKE
EEEKDKEEGEEKEERAVAEEMMPAAEKEEAKLPPPPLTPPAPSPPPPLPPPSTSPPPPLC
PPPPPPVSPPPLPSPPPPPAQEEQEESPPPVVPATCSRKRGRPPLTPSQRAEREAARAGP
EGTSPPTPTPSTATGGPPEDSPTMAPKSTTFLKNIRQFIMPVVSARSSRVIKTPRRFMDE
DPPKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPHAPTPPSTPVPLPEKRRSILREPTF
RWTSLTRELPPPPPAPPPPPAPSPPPAPATSSRRPLLLRAPQFTPSEAHLKIYESVLTPP
PLGAPEAPEPEPPPADDSPAEPEPRAVGRTNHLSLPRFAPVVTTPVKAEVSPHGAPALSN
GPQTQAQLLQPLQALQTQLLPQALPPPQPQLQPPPSPQQMPPLEKARIAGVGSLPLSGVE
EKMFSLLKRAKVQLFKIDQQQQQKVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESV
EAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDLATEDT
SSASETESVPSRSRRGKVEAAGPGGESEPTGSGGTLAHTPRRSLPSHHGKKMRMARCGHC
RGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKGRTIVKTLLP
WDSDESPEASPGPPGPRRGAGAGGPREEVVAPPGPEEQDSLLQRKSARRCVKQRPSYDIF
EDSDDSEPGGPPAPRRRTPRENELPLPEPEEQSRPRKPTLQPVLQLKARRRLDKDALAPG
PFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSVPGGPPMVCLLCAS
KGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGRGSKHLLECE
RCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGATPGKNWDVEWSGDYSLCPRCT
QLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYT
CGPCAGAAQPRWREALSGALQGGLRQVLQGLLSSKVVGPLLLCTQCGPDGKQLHPGPCGL
QAVSQRFEDGHYKSVHSFMEDMVGILMRHSEEGETPERRAGGQMKGLLLKLLESAFGWFD
AHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQEPETPELGQPPGDPSAAFQGKDP
AAFSHLEDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGSLKNV
HAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQDDKKVFCQKHTDLL
DGKEIVNPDGFDVLRRVYVDFEGINFKRKFLTGLEPDAINVLIGSIRIDSLGTLSDLSDC
EGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPAHLEAAEENQTIVHSPA
PSSEPPGGEDPPLDTDVLVPGAPEHHSPIQNLDPPLRPDSGSAPPPAPRSFSGARIKVPN
YSPSRRPLGGVSFGPLPSPGSPSSLTHHIPTVGDPDFPAPPRRSRRPSPLAPRPPPSRWA
SPPLKTSPQLRVPPPTSVITALTPTSGELAPPGPAPSPPPSEDLGPDFEDMEVVSGLSAA
DLDFAASLLGTEPFQEEIVAAGAMGSSHGGPGDSSEEESSPTSRYIHFPVTVVSAPGLAP
SATPGAPRIEQLDGVDDGTDSEAEAVQQPRGQGTPPSGPGVVRAGVLGAAGDRARPPEDL
PSEIVDFVLKNLGGPGDGGAGPREESLPPAPPLANGSQPSQGLTASPADPTRTFAWLPGA
PGVRVLSLGPAPEPPKPATSKIILVNKLGQVFVKMAGEGEPVPPPVKQPPLPPTISPTAP
TSWTLPPGPLLGVLPVVGVVRPAPPPPPPPLTLVLSSGPASPPRQAIRVKRVSTFSGRSP
PAPPPYKAPRLDEDGEASEDTPQVPGLGSGGFSRVRMKTPTVRGVLDLDRPGEPAGEESP
GLLQERSPLLPLPEGGPPQVPDGPPDLLLESQWHHYSGEASSSEEEPPSPDDKENQAPKR
TGPHLRFEISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMSGARLLGIHH
DAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCTFDMFNFLAS
QHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVYRSAIHGRGL
FCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVDATMHGNAAR
FINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNKLPCNCGAKR
CRRFLN
NT seq 7581 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcactgactgaacttctccggcgggcccaggcaccccaagcaccccggagc
cgggcatgtgagccctccaccccccggcggtctcggggacggcccccaggacggccagca
ggcccctgcaggaggaagcagcaagcagtagtggtggcagaagcagctgtgacaatcccc
aaacctgagcccccacctcctgtggttccagtgaaacatcagactggcagctggaaatgc
aaggaggggcccggtccaggacctgggacccccaggcgtggaggacagtcaagccgtgga
ggccgtggaggcaggggccgcggccgaggtggtgggctcccctttgtgatcaagtttgtt
tcaagggccaaaaaagtaaagatgggacaattgtccttgggactcgaatcaggtcaaggt
caacatgaggaaagttggcaggatgccccccaaagaagagttggatctggacagggaggg
agcccttgctggaaaaagcaggaacagaagctggatgacgaggaagaagagaagaaagaa
gaagaagaaaaagacaaggaggagggagaagagaaggaagaaagagctgtagcagaggag
atgatgccagctgcggaaaaggaagaggcaaagctgccaccaccgcctctgactcctcca
gccccttcacctcctccacccctcccacccccttcgacatctcctccacccccactctgc
cctccaccaccacccccagtgtccccaccacctctaccatcccctccaccgcctcctgcc
caagaggagcaggaagaatcccctcctcctgtggtcccagctacgtgctccaggaagagg
ggccggcctcccctgactcccagccagcgggcggagcgggaagctgctcgggcagggcca
gagggcacctctcctcccactccaacccccagcaccgccacgggaggccctccggaagac
agtcccaccatggcccccaaaagcaccaccttcctgaagaatatccggcagtttattatg
cctgtggtgagtgcccgctcctcccgtgtcatcaagacaccccggcgatttatggatgaa
gacccccccaaacccccaaaggtggaggtctcacctgtcctgcgacctcccattaccacc
tccccacctgttccccaggagccagcaccagtcccctctccaccacatgccccaactcct
ccatctaccccagttccactccctgagaagagacggtccatcctaagggaacccacattt
cgctggacctcactgacccgggagctgccccctcctcccccagcccctccacctcccccg
gccccctccccaccccctgctcctgccacctcctcccggaggcccctactccttcgggcc
cctcagtttaccccaagcgaagcccacctgaagatctacgaatcggtgcttactcctcct
cctcttggggctcctgaagcccctgagccagagcctcctcctgccgatgactctccagct
gagcctgagcctcgggcagtgggccgcaccaaccacctcagcctgcctcgattcgcccct
gtggtcaccactcctgttaaggccgaggtgtcccctcacggggctccagctctgagcaac
gggccacagacacaggctcagctactgcagcccctgcaggccttgcaaacccagctcctg
ccccaggcactaccgccaccacagccacagctgcagccaccgccgtcaccacagcagatg
cctcccctggaaaaagcccggattgcgggcgtgggttccttgccgctgtctggggtagag
gagaagatgttcagcctcctcaagagagccaaagtgcagctattcaagatcgatcagcag
cagcagcagaaggtggcagcttccatgccgctgagccctggagggcagatggaggaggtg
gccggggctgtcaagcagatctccgacagaggccctgtccggtctgaagatgagtcggtg
gaagctaagagagagcggccctcaggtcccgagtcccctgtgcaaggtccccgcatcaaa
catgtctgccgtcatgctgctgtggccctgggtcaggcccgggccatggtgcctgaagat
gtccctcgcctcagtgccctccctctccgggatcggcaggacctcgccacagaggataca
tcatcggcgtccgagactgagagtgtcccgtcacggtcccggcggggaaaggtggaggca
gcaggccctgggggagaatcagagcccacaggttctggagggaccctggcccacacaccc
cggcgctcactgccctcccatcacggcaagaagatgcgcatggctcgatgtggacactgt
cggggctgcctacgtgtgcaggactgtgggtcctgtgtcaactgcctagacaagcccaag
tttgggggccctaacaccaagaagcagtgctgtgtataccggaagtgtgacaaaatagag
gctcggaagatggaacgactggctaaaaaaggccggacgatagtgaagacgctgttgccc
tgggattccgatgaatctcctgaggcctcccctggtcctccaggcccacgccggggggcg
ggagctggggggccccgggaggaggtggtggcccccccagggcccgaggagcaggactcc
ctcctgcagcgcaagtcagctcggcgctgcgtcaaacagcgaccctcctatgatatcttc
gaggattcggatgactcggagcccgggggcccccctgctcctcggcgtcggaccccccga
gaaaatgagctgccactgccagaacctgaggagcagagccggccccgcaaacccaccctg
cagcctgtgttgcagctcaaggcccgaaggcgcctggacaaggatgctttggcccctggc
ccctttgcttcttttcccaatggctggactggaaagcagaagtctcccgatggtgtgcac
cgcgtccgtgtggattttaaggaggattgtgatttagagaacgtgtggctgatggggggc
ctgagtgtgctcacctctgtgccagggggccccccgatggtgtgcttgctgtgtgccagc
aaaggactccacgagctggtgttctgtcaagtctgctgtgacccattccacccattctgc
ctggaggaggctgagcggcccctgccccagcatcacgacacctggtgctgccgtcgctgc
aaattctgccacgtctgtggacgcaaaggtcgtggatccaagcacctcctggagtgcgag
cgctgccgccatgcataccacccggcctgtctggggcccagctatccaacccgggccacg
cgcaaacggcgccactggatctgttcagcctgtgtgcgctgtaagagctgtggggcaact
ccaggcaagaactgggacgtcgagtggtctggagattacagcctctgccccaggtgcacc
cagctatatgagaaaggaaactactgcccgatctgtacacgctgctatgaagacaacgac
tatgagagcaagatgatgcagtgcgcacagtgcgatcactgggtgcatgccaagtgcgag
gggctctcagatgaagactacgagatcctttcaggactgccagactcggtgctgtacacc
tgcggaccgtgtgctggggcagcgcagccccgctggcgagaggccctgagcggggccctc
caggggggcctgcgccaggtgctccagggcctgctgagctccaaggtggtgggcccactg
ctgctctgcacccagtgtgggccagatgggaagcaactgcacccaggaccctgcggcctg
caagctgtgagtcagcgcttcgaggatggccactacaagtctgtgcacagcttcatggag
gacatggtgggcatcctcatgcggcactcggaggagggagagactccggagcgccgggct
ggaggccagatgaaggggctcctgctgaagctgctagaatctgcgttcggctggttcgac
gcccacgaccccaagtactggcgacggagtacccggctgccaaacggagtccttcccaat
gcggtgttgcccccatccctggatcatgtctatgcgcagtggagacagcaggaaccagag
accccagaattagggcagcctccaggggatccctcagcagcattccagggcaaggatcca
gctgccttctcacacctggaggacccccgtcagtgcgcactctgcctcaaatacggggat
gcagactccaaggaggcggggcggctcttgtacatcgggcagaacgagtggacacacgtc
aactgtgccatctggtcggcggaagtctttgaggagaacgacggctccctcaagaatgtg
catgctgctgtggcccgagggaggcagatgcgctgcgagctctgcctgaagcctggcgcc
acggtgggctgctgcctgtcctcctgcctcagcaacttccacttcatgtgtgcccgggcc
agctactgcatcttccaggatgacaagaaagtcttctgccagaaacacactgatctcctg
gatggcaaggaaattgtgaaccccgatggttttgatgttctccgccgagtctatgtggac
ttcgagggcatcaacttcaagcggaagttcttgacggggcttgaacccgatgccatcaac
gtgctcattggttccatccgcattgactctctgggtactctgtctgatctctcggactgc
gagggacggctcttccccattggctaccagtgctcccgtctgtactggagcacagtggat
gctcggaggcgctgctggtatcggtgccgaattctggagtatcggccatgggggccgagg
gaagagccagctcacctggaggctgcagaggagaaccagaccattgtgcacagccccgcc
ccttcctcagagcccccaggtggtgaggaccccccactggacacagatgttcttgtccct
ggagctcctgagcaccactcgcccattcagaacctggaccctccactgcggccagattca
ggcagcgcccctcccccagccccccgttctttttcgggggctcgaatcaaagtgcccaac
tactcgccatcccggaggcccttggggggtgtctcctttggccccctgccctcccctgga
agtccatcttcactgacccaccacatccccacagtgggagacccggacttcccagctccc
cccagacgttcccgtcgtcccagccctttggctcccaggccgcctccatcacggtgggcc
tcccctcctctaaaaacctcccctcagctcagggtgccccctcctacctcagtcatcaca
gccctcacacctacctcaggggagctggctccccctggcccggccccatcaccaccaccc
tctgaagacctgggcccagacttcgaggacatggaggtggtgtcaggactgagtgctgct
gacctggacttcgcggccagcctgctggggactgagcccttccaggaagagattgtagcc
gctggggccatggggagcagccacgggggcccgggggacagctccgaggaggagtccagc
cccacctcccgctacatccacttccctgtgactgtggtgtccgcccctggtctggccccc
agcgctacccctggagccccccgcattgaacagctggacggcgtggacgacggcactgac
agtgaggctgaggcggtgcagcagcctcggggccagggcactcctccttcggggccagga
gtagtccgggcaggggtccttggggctgcaggggacagggcccggcctcctgaggacctg
ccatcggaaattgtggattttgtgttgaagaacctagggggtcctggggatggaggtgct
ggccctagagaggagtcactccccccggcgcctcccctggctaatggcagccagccctcc
caaggcctgaccgccagcccagctgaccccacccgcacatttgcctggctcccaggggcc
ccaggggtccgggtgttaagccttggccctgcccctgagccccccaaacccgccacatcc
aaaatcatacttgtcaacaagctggggcaagtatttgtgaagatggctggggagggtgaa
cctgtcccacccccagtgaagcagccacctttgccccccaccatttcccccacggctccc
acctcctggactctgcccccaggccccctcctcggcgtgctgcccgtggtcggagtggtc
cgccctgccccgcccccgccaccccctcccctgacgctggtgctgagcagtgggccagcc
agcccgccccgccaggccatccgcgtcaagagggtgtccactttctccggccggtccccg
ccagcacctcccccatacaaagccccccggctggatgaagatggagaggcctcagaggat
acccctcaggttccagggcttggcagtggcgggtttagccgtgtgaggatgaaaaccccc
acagtgcgtggggtccttgacctggatcggcctggggagcccgctggggaagaaagtcct
gggctcctccaggaacggtcccctttgctgccacttccggaaggtggtcctccccaggtc
cccgatggtcccccagacctgctgcttgagtcccagtggcaccactattcaggtgaggct
tcgagctctgaggaagagcctccatccccagacgataaagagaaccaggccccaaaacgg
actggcccacatctgcgcttcgagatcagcagtgaggatgggttcagcgttgaggcagag
agcttggagggggcgtggagaactctgatcgagaaagtgcaagaggcccgagggcatgcc
cgactcagacatctctcctttagtggaatgagtggggcgagactcctgggcatccaccat
gatgctgtcatcttcctggccgagcagctccccggagcccagcgttgccagcactataag
ttccgttaccaccagcagggagagggccaggaggagccgcccctgaatccccatggggct
gctcgggcagaggtctatctccggaagtgcacctttgacatgttcaacttcctggcctcc
cagcaccgggtgctccctgagggggccacctgtgatgaggaagaggatgaggtgcagctc
aggtcaaccagacgtgccaccagcctggagctgcccatggccatgcgttttcgtcacctt
aagaagacgtccaaagaagctgtgggtgtctacagatcagccatccacgggcgaggcctg
ttctgtaagcgcaacatcgacgcgggggagatggtcatcgagtactctggcattgtcatc
cgctcggtgttgactgacaagcgggagaagttctacgatgggaagggcatcgggtgctat
atgttccgcatggatgactttgatgtagtggacgccacgatgcatggcaatgccgcccgc
ttcatcaaccactcctgtgagcccaactgcttctctcgggtcatccacgtggagggccag
aaacacattgttatcttcgccctgcgccgcatcctgcgtggtgaggagctcacctacgac
tacaagttccccatcgaggatgccagcaacaagctgccctgcaactgtggcgccaagcgc
tgccgtcggttccttaactga

DBGET integrated database retrieval system