KEGG   Pan troglodytes (chimpanzee): 456052Help
Entry
456052            CDS       T01005                                 

Definition
cytochrome P450 2B6-like
Orthology
K17709  
cytochrome P450, family 2, subfamily B, polypeptide 6 [EC:1.14.13.-]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Arachidonic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    456052
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    456052
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    456052
   00982 Drug metabolism - cytochrome P450
    456052
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     456052
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP2 family
   456052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 491 aa AA seqDB search
MELSVLLFLALLTGLLLLLVQRHPNSHGTLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAIMDPVYQGYGVLFANGNR
WKVLRRFSVTIMRDFGMGKRSVEERIQDEAQCLIEELRKSKGALVDPTFLFHSITANIIC
SIVFGKRFHYQDQEFLKMLNLFCQSFSLISSISSQLFELFSGFLKYFPGAHRQLYKNLQE
INAYIGHSVEKHRETLDPSAPRDLIDTYLLHMEKEKSNPHSEFSHQNLIINTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYKEIEQVVGPHRPPALDDRAKMPYTEAVIHEIQRFA
DLLPMGVPHIVTQHTSFXGYTIPKDTEVFLILSTALRDPHYFEKPDAFNPDHFLDANGAL
KKNEAFIPFSLGKRICLGEGITRAELFLFFTTILQNFSVASPVAPEDIDLTPQECGVGKI
PPTYQICFLPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcgtcctcctcttccttgcactcctcacaggcctcttgctactcctggtt
cagcgtcaccctaactcccatggcaccctcccaccagggccccgccctctgccccttttg
gggaaccttctgcagatggacagaagaggcctactcaaatcctttctgaggttccgagag
aaatatggggacgtcttcacggtacacctgggaccgaggcccgtggtcatgctgtgtgga
gtagaggccatacgggaggccctggtggacaaggctgaggccttctctggccggggaaaa
atcgccatcatggacccagtctaccagggatatggcgtgctctttgccaatggaaaccgc
tggaaggtgcttcggcgattctctgtgaccatcatgagggacttcgggatgggaaagcgg
agtgtggaggagcggattcaggacgaggctcagtgtctgatagaggaacttcggaaatcc
aaaggagccctcgtggaccccaccttcctcttccattccattaccgccaacatcatctgc
tccatcgtctttggaaaacgcttccactaccaagatcaagagttcctgaagatgctgaac
ttgttctgccagagtttctcactcatcagctctatatccagccagctgtttgagctcttc
tctggcttcttgaaatactttcctggggcacacaggcaactctacaaaaaccttcaggaa
atcaatgcttacattggccacagtgtggagaagcaccgtgaaaccctggaccccagtgcc
cccagggacctcattgacacctacctgctccacatggaaaaagagaaatccaacccacac
agtgaattcagccaccagaacctcatcatcaacacgctctcgctcttctttgctggcact
gagaccaccagcaccactctccgctacggcttcctgctcatgctcaaataccctcatgtc
gcagagagagtctacaaggagattgaacaggtggttggcccacatcgccctccagcgctt
gatgaccgagccaaaatgccatacacagaggcagtcatccatgagattcagagatttgcc
gaccttctccccatgggtgtgccccacattgtcacccaacacaccagcttctgagggtac
accatccccaaggacacggaagtatttctcatcctgagcactgctctccgtgacccacac
tactttgaaaaaccagacgccttcaatcctgaccactttctggatgccaatggggcactg
aaaaagaatgaagcttttatccccttctccttagggaagcggatttgtcttggtgaaggc
atcacccgtgcggaattgttcctcttcttcaccaccatcctccagaacttctccgtggcc
agccccgtggctcctgaagacatcgatctgacaccccaggagtgtggtgtgggcaaaata
cccccaacataccagatctgcttcctgccccgctga

DBGET integrated database retrieval system