KEGG   Pan troglodytes (chimpanzee): 456052Help
Entry
456052            CDS       T01005                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 2B6-like
Organism
ptr  Pan troglodytes (chimpanzee)
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 456052
NCBI-ProteinID: XP_024207160
Position
19
AA seq 491 aa AA seqDB search
MELSVLLFLALLTGLLLLLVQRHPNSHGTLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAIMDPVYQGYGVLFANGNR
WKVLRRFSVTIMRDFGMGKRSVEERIQDEAQCLIEELRKSKGALVDPTFLFHSITANIIC
SIVFGKRFHYQDQEFLKMLNLFCQSFSLISSISSQLFELFSGFLKYFPGAHRQLYKNLQE
INAYIGHSVEKHRETLDPSAPRDLIDTYLLHMEKEKSNPHSEFSHQNLIINTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYKEIEQVVGPHRPPALDDRAKMPYTEAVIHEIQRFA
DLLPMGVPHIVTQHTSXRGYTIPKDTEVFLILSTALRDPHYFEKPDAFNPDHFLDANGAL
KKNEAFIPFSLGKRICLGEGITRAELFLFFTTILQNFSVASPVAPEDIDLTPQECGVGKI
PPTYQICFLPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagctcagcgtcctcctcttccttgcactcctcacaggcctcttgctactcctggtt
cagcgtcaccctaactcccatggcaccctcccaccagggccccgccctctgccccttttg
gggaaccttctgcagatggacagaagaggcctactcaaatcctttctgaggttccgagag
aaatatggggacgtcttcacggtacacctgggaccgaggcccgtggtcatgctgtgtgga
gtagaggccatacgggaggccctggtggacaaggctgaggccttctctggccggggaaaa
atcgccatcatggacccagtctaccagggatatggcgtgctctttgccaatggaaaccgc
tggaaggtgcttcggcgattctctgtgaccatcatgagggacttcgggatgggaaagcgg
agtgtggaggagcggattcaggacgaggctcagtgtctgatagaggaacttcggaaatcc
aagggagccctcgtggaccccaccttcctcttccattccattaccgccaacatcatctgc
tccatcgtctttggaaaacgcttccactaccaagatcaagagttcctgaagatgctgaac
ttgttctgccagagtttctcactcatcagctctatatccagccagctgtttgagctcttc
tctggcttcttgaaatactttcctggggcacacaggcaactctacaaaaaccttcaggaa
atcaatgcttacattggccacagtgtggagaagcaccgtgaaaccctggaccccagtgcc
cccagggacctcattgacacctacctgctccacatggaaaaagagaaatccaacccacac
agtgaattcagccaccagaacctcatcatcaacacgctctcgctcttctttgctggcact
gagaccaccagcaccactctccgctacggcttcctgctcatgctcaaataccctcatgtc
gcagagagagtctacaaggagattgaacaggtggttggcccacatcgccctccagcgctt
gatgaccgagccaaaatgccatacacagaggcagtcatccatgagattcagagatttgcc
gaccttctccccatgggtgtgccccacattgtcacccaacacaccagcnnccgagggtac
accatccccaaggacacggaagtatttctcatcctgagcactgctctccgtgacccacac
tactttgaaaaaccagacgccttcaatcctgaccactttctggatgccaatggggcactg
aaaaagaatgaagcttttatccccttctccttagggaagcggatttgtcttggtgaaggc
atcacccgtgcggaattgttcctcttcttcaccaccatcctccagaacttctccgtggcc
agccccgtggctcctgaagacatcgatctgacaccccaggagtgtggtgtgggcaaaata
cccccaacataccagatctgcttcctgccccgctga

DBGET integrated database retrieval system