KEGG   Pan troglodytes (chimpanzee): 456067Help
Entry
456067            CDS       T01005                                 

Gene name
ARHGEF1
Definition
(RefSeq) Rho guanine nucleotide exchange factor 1
  KO
K12330  
Rho guanine nucleotide exchange factor 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Vascular smooth muscle contraction
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    456067 (ARHGEF1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    456067 (ARHGEF1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    456067 (ARHGEF1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    456067 (ARHGEF1)
   05205 Proteoglycans in cancer
    456067 (ARHGEF1)
Membrane trafficking [BR:ptr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    456067 (ARHGEF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 1025 aa AA seqDB search
MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLEQVKRRPAHLM
ALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPNVAF
ELDRTRADLISEDVQRRFVQEVVQSQQAAVGRQLEDFRSKRLMGMTPWEQELAQLEAWVG
RDRASYEARERHVAERLLMHLEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKS
GRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATD
RKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSSPQGPMSLESL
APPESTDEGAETERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDP
SSATAVLGPARRATPEPGDEGEPGRSGLELEPEEPPGWRELVPPDTLHSLPKSQVKRQEV
ISELLVTEAAHVRMLRVLHDLFFQPMAECLFFPLEELQNIFPSLDELIEVHSLFLDSLVK
RRQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFV
QEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILH
HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTK
DKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVAT
DHKAFYVLFTWDQEAQIYELVAQTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSST
REPLLSSSENGNGGRETSPADARTERILSDLLPFCRPGPEGQLAATALRKGVGGGILPPA
TPPVSAWGELCPPAWLHLRFPPRKAFCKERNGGEDVRDHPHPHSCRSISHPEGLRRGSCG
PRLGGAQLGLLAPHEPRPSLPPALCLGDSGLHSGGHHGDPGHLSIACGGHPSTPTPKCLR
SVFIP
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggaagacttcgcccgaggggcggcctccccaggcccctcccggcctggcctggttccc
gtcagcatcatcggggctgaggatgaggattttgagaacgagctggagacaaactcggaa
gagcaaaacagccagttccagagcctggagcaggtgaagcggcgcccagcccacctcatg
gccctcctgcagcacgtggccctgcagtttgagccaggacccctgctttgctgtctgcat
gccgacatgctgggctcactgggccccaaggaggccaagaaggccttcctggacttctac
cacagcttcctggagaagacagcggttctccgggtgccggtccctcccaacgtcgccttt
gaacttgaccgcactagggctgacctcatctccgaggatgtccagcggcggttcgtgcag
gaggtggtgcaaagccagcaggcagccgtgggccggcagctggaggacttccgctccaag
cggctcatgggcatgacgccctgggagcaggagctggcccagctggaggcttgggttggg
cgggaccgagccagctacgaggcccgggagcggcacgtggcggagcggctgctcatgcac
ctggaggagatgcaacataccatctctaccgacgaagaaaagagtgctgccgtggtcaac
gccattggcctgtacatgcgccaccttggggtgcggaccaagagtggagacaagaagtcg
gggaggaacttcttccggaaaaaggtgatggggaaccggcggtcggacgagcctgccaag
accaagaaggggctgagcagcatcctggatgccgcccgctggaaccggggagagccccag
gttccagattttcgacacctcaaagcagaggttgatgccgagaagccaggtgctacagac
cggaagggaggcgtggggatgccctctcgggaccggaatatcggggctcctgggcaggac
acccctggagtctctctgcaccctctgtccctggacagcccagaccgggaaccaggtgct
gacgcccccctggagctgggggactcatccccacagggcccaatgagcctggagtccttg
gcgcccccagagagtaccgatgagggggccgaaaccgagagaaggtggaagaggctatca
gggcgtctggggcgctcagagagcctgcgggtgagtgaccgccgccggccttcccggggc
agcctcggggctaagggccggggtgggggccgctcccggagcgacgtggacatggacccc
agttccgccacggcagtgcttggccctgcccgacgagccacccccgagcctggagatgag
ggggagccggggcggtcgggactggagcttgaaccagaagagcctcccggctggcgggaa
ctcgtccccccagacaccctgcacagcctgcccaagagccaggtgaagcggcaggaggtc
atcagcgagctgctggtgacagaggcggcccacgtgcgcatgctgcgggtgctgcacgac
ctcttcttccagcccatggcagaatgcctgttcttccccttggaggagctgcagaacatc
ttccccagcctggacgagctcatcgaggtgcattccctgttcctcgattccctggtgaag
cggaggcaggagagtggctacctcatcgaggagatcggagacgtgctgctggcccggttt
gatggtgctgagggctcctggttccagaaaatctcctcccgcttctgcagccgccagtca
tttgccttagagcagctcaaagccaagcaacgcaaggaccctcggttctgtgccttcgtg
caggaagctgagagccgcccgcggtgccgccgcctgcagctgaaggacatgatccccacg
gagatgcagcggctaaccaagtaccccctgctcctgcagagcatcgggcagaacacagaa
gagcccacagaacgggagaaagtggagctggcagccgagtgctgccgggaaattctacac
cacgtcaaccaagccgtgcgtgacatggaggacctgctgaggctcaaggactatcagcgg
cgcctggacttgtcccaccttcggcagagcagcgaccctatgctgagcgaattcaagaac
ctggacatcaccaagaaaaaattggtccacgagggcccactgacgtggcgggtgactaag
gacaaggcagtggaggtgcatgtgctgctgctggacgacctgctgctgctgctccagcgc
caggacgagcggctgctgctcaagtcccatagccggacactgacgcccacacccgatggc
aagaccatgctgcggcccgtgctgcggctcacctccgccatgacccgcgaggtggccacc
gatcacaaagccttctacgtcctttttacctgggaccaggaggcccagatatacgagctg
gtggcacagactgtgtcggagcggaaaaactggtgtgccctcatcactgagactgccgga
tccctgaaagtccctgcccctgcctctcgccctaagccccggcccagcccgagcagcacc
cgagaacccctcctcagcagctctgagaacggcaatggtggccgagagacgtctccagct
gatgcccggactgagagaatcctcagtgacctcctgcccttctgcagaccaggccccgag
ggccagctcgctgccacggcccttcggaaaggagttggaggaggaattttgccgcctgcg
acccctcctgtctcagcttggggggaactctgtcccccagcctggctgcacttgaggttc
ccgcccaggaaggccttttgcaaggagaggaatgggggagaggacgtgagggaccacccc
cacccacacagctgccgcagcatctcacaccccgagggcctgaggagagggagctgtggg
ccacgcctgggaggggcccagctggggttactggccccgcatgagcctcggccatctctc
cctcctgccctctgcttgggggactcagggctccattctggagggcaccacggtgacccg
ggccatctcagtattgcctgtgggggccacccctccacccccacccccaagtgccttcgc
tctgtttttataccctga

DBGET integrated database retrieval system