KEGG   Pan troglodytes (chimpanzee): 456196Help
Entry
456196            CDS       T01005                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00500  Starch and sucrose metabolism
ptr01100  Metabolic pathways
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04910  Insulin signaling pathway
ptr04922  Glucagon signaling pathway
ptr04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    456196 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    456196 (GYS1)
   04152 AMPK signaling pathway
    456196 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    456196 (GYS1)
   04922 Glucagon signaling pathway
    456196 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    456196 (GYS1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     456196 (GYS1)
Glycosyltransferases [BR:ptr01003]
 Polysaccharide
  Storage polysaccharide
   456196 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 456196
NCBI-ProteinID: XP_016791972
Ensembl: ENSPTRG00000011269
UniProt: K7DM65
Position
19
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacgcggtgctcttcgaagtggcctgggaggtggctaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacaggggacgaatggggcgac
aactacttcctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaggacactggattccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgagggaggccctctggtggtgctcctggacgtgggt
gcctcagcttgggccctggagcgctggaagggagagctctgggatacctgcaacatcggg
gtgccgtggtacgaccgcgaggccaacgacgctgtcctctttggctttctgaccacctgg
ttcctgggtgagttcctggcacagagtgaggagaagccacatgtggttgctcacttccat
gagtggttggcaggcgttggactctgcctgtgtcgtgcccggcgactgcctgtagcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgccgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggggagaggcagatctaccac
cgctactgcatggaaagggcggcagcccactgcgctcacgtcttcactactgtgtcccag
atcaccgccatcgaggcacagcacttgctcaagaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttatacttctttatcgccggccgctatgagttctccaacaagggtgctgac
gtcttcctggaggcattggctcggctcaactatctgctcagagtgaacggcagcgagcag
acagtggttgccttcttcatcatgccagcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagctgtgcgcaaacagctttgggacacagccaacacggtgaaggaaaagttc
gggaggaagctttatgaatccttactggttgggagccttcccgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctccctgtggactatgaggagtttgtccgtggctgt
caccttggagtcttcccctcctactatgagccttggggctacacgccggctgagtgcacg
gttatgggaatccccagtatctccaccaatctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattcttgaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagtttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccaacgaggcggatgcggcccaggggtaccgctacccacggccagcc
tcggtgccaccgtcgccctcgctgtcacgacactccagcccgcaccagagtgaggacgag
gaggatccccggaacgggccgctggaggaagacggcgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaacatccgtgcaccagagtggccgcgccgagcgtcctgcacc
tcctccaccagcggcagcaagcgcaactctgtggacacggccacctccagctcactcagc
accccgagcgagcccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system