KEGG   Pan troglodytes (chimpanzee): 456406Help
Entry
456406            CDS       T01005                                 

Gene name
GEMIN7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    456406 (GEMIN7)
Spliceosome [BR:ptr03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    456406 (GEMIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 131 aa AA seqDB search
MQTPVNIPVPVLRLPRGPDGFCRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARA
ALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLR
CSDIISYTFKP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactccagtgaacattcccgtgcctgtgctccggctgccccggggccctgatggc
ttctgccgtggctttgcccctgacggacgcagagcccccttgaggccagaggttcctgaa
atccaggagtgtcccatagctcaagaatccctggaatcccaggagcagcgggcacgagcc
gcccttcgggagcgttacctccgcagcctgctggccatggtgggtcatcaggtgagcttc
acgttgcacgagggtgtgcgtgtggccgcccactttggagccaccgacctggatgtggcc
aacttctacgtgtcacagctgcagactcccataggtgtgcaagcagaggcgctactccga
tgtagtgacattatttcatataccttcaagccataa

DBGET integrated database retrieval system