KEGG   Pan troglodytes (chimpanzee): 456527Help
Entry
456527            CDS       T01005                                 

Gene name
PADI2
Definition
peptidyl arginine deiminase, type II
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 665 aa AA seqDB search
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgagcggaccgtgcggctgcagtacgggagccgcgtggaggcggtgtacgtg
ctgggcacctacctctggaccgatgtctacagcgcggccccagccggggcccaaaccttc
agcctgaagcactcggaacacgtgtgggtggaggtggtgcgtgatggggaggctgaggag
gtggccaccaatggcaagcagcgctggcttctctcgcccagcaccaccctgcgggtcacc
atgagccaggcgagcaccgaggccagcagtgacaaggtcaccgtcaactactatgacgag
gaagggagcattcccatcgaccaggcggggctcttcctcacggccattgagatctccctg
gatgtggacgcagaccgggatggtgtggtggagaagaacaacccaaagaaggcatcttgg
acctggggccctgagggccagggggccatcctgctggtgaactgtgaccgagagacaccc
tggctgcccaaggaggactgccgtgatgagaaggtctacagcaaggaagatctcaaggac
atgtcccagatgatcctgcggaccaaaggccccgaccgcctccccgccggatatgagata
gttctgtacatttccatgtcagactcagacaaagtgggcgtgttctacgtggagaaccca
ttctttggccaacgctatatccacatcctgggccggcggaagctctaccatgtggtcaag
tacacgggtggctccgcggagctgctgttcttcgtggaaggcctctgtttccccgacgag
ggcttctcaggcctggtctccatccatgtcagcctgctggagtacatggcccaggacatt
cccctgactcccatcttcacggacaccgtgatattccggattgctccgtggatcatgacc
cccaacatcctgcctcccgtgtcggtgtttgtgtgctgcatgaaggataattacctgttc
ctgaaagaggtgaagaaccttgtggagaaaaccaactgtgagctgaaggtctgcttccag
tacctaaaccgaggcgatcgctggatccaggatgaaattgagtttggctacatcgaggcc
ccccataaaggcttccccgtggtgctggactccccccgagatggaaacctaaaggacttc
cctgtgaaggagctcctgggcccagattttggctacgtgacccgggagcccctctttgag
tctgtcaccagccttgactcgtttggaaacctggaggtcagtcccccagtgaccgtgaac
ggcaagacatacccgcttggccgcatcctcatcgggagcagctttcctctgtctggtggt
cggaggatgaccaaggtggtgcgtgacttcctgaaggcccagcaggtgcaggcgcccgtg
gagctctactcagactggctgactgtgggccacgtggatgagttcatgtcctttgtcccc
atccccggcacaaagaaattcctgctactcatggccagcacctcggcctgctacaagctc
ttccgagagaagcagaaggacggccatggagaggccatcatgttcaaaggcttgggtggg
atgagcagcaagcgaatcaccatcaacaagattctgtccaacgagagccttgtgcaggag
aacctgtacttccagcgctgcctggactggaaccgtgacatcctcaagaaggagctggga
ctgacagagcaggacatcattgacctgcccgctctgttcaagatggacgaggaccaccgt
gccagagccttcttcccaaacatggtgaacatgatcgtgctggacaaggacctgggcatc
cccaagccattcgggccacaggttgaggaggaatgctgcctggagatgcacgtgcgtggc
ctcctggagcccctgggcctcgaatgcaccttcatcgacgacatttctgcctaccacaaa
tttctgggggaagtccactgtggcaccaacgtccgcaggaagccgttcaccttcaagtgg
tggcacatggtgccctga

DBGET integrated database retrieval system