KEGG   Pan troglodytes (chimpanzee): 456557Help
Entry
456557            CDS       T01005                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 400 aa AA seqDB search
MTSPLSPIPSPGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEK
AREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHRDSSYYLAVSDLTLLMQQRLVSFQY
HNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVQKKIQNRRHLDFLDILLG
AWDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGD
QDSFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYA
LHRNSAVWPDPEVFDPLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCL
LRFEFSLDPSRLPIKMPQLVLCSKNGFHLHLKPLGPGSGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccctctctctcccatcccttccccagggagaggcctgctggttcttgagggg
cccaagtggttgcagcaccgcaagctgctcacacctggctttcattatgatgtgctgaag
ccctatgtggccgtgttcactgagtctacacgtatcatgctggacaagtgggaagagaaa
gctcgggagggtaagtcctttgacatcttctgcgatgtgggtcacatggcgctgaacaca
ctcatgaagtgcacctttggaagaggagacaccggcctgggccacagggacagcagctac
taccttgcagtcagcgatctcactctgttgatgcagcagcgccttgtgtccttccagtac
cataatgacttcatctactggctcaccccacatggccgccgcttcctgcgggcctgccag
gtggcccatgaccatacagaccaggtcatcagggagcggaaggcagccctgcaggatgag
aaggtgcagaagaagatccagaaccggaggcacctggacttcctggacattctcctgggt
gcctgggatgaagatgacatcaaactgtcagatgcagacctccgggctgaagtggacaca
ttcatgtttgaaggccatgacaccaccaccagtggtatctcctggtttctctactgcatg
gccctgtaccctgagcaccagcatcgttgtagagaggaggtccgtgagatcctaggggac
caggactccttccagtgggatgatctgggcaagatgacttatctgaccatgtgcatcaag
gagagcttccgcctctacccacctgtgccccaggtgtaccgccagctcagcaagcctgtc
acctttgtggatggccggtctctacctgcaggaagcctgatctctatgcatatctatgcc
ctccataggaacagtgctgtatggcccgaccctgaggtctttgaccctctgcgcttttcc
actgagaatgcatccaaacgccatccctttgcctttatgcccttctctgctgggcccagg
aactgcattgggcagcagtttgccatgagtgagatgaaggtggtcacagccatgtgcttg
ctccgctttgagttctctctggacccctcacggctgcccatcaagatgccccagcttgtc
ctgtgctccaagaatggctttcacctccacctgaagccactgggccctgggtctgggaag
tag

DBGET integrated database retrieval system