KEGG   Pan troglodytes (chimpanzee): 456557Help
Entry
456557            CDS       T01005                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     456557
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP4 family
   456557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 400 aa AA seqDB search
MTSPLSPIPSPGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEK
AREGKSFDIFCDVGHMALNTLMKCTFGRGDTGLGHRDSSYYLAVSDLTLLMQQRLVSFQY
HNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVQKKIQNRRHLDFLDILLG
AWDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGD
QDSFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYA
LHRNSAVWPDPEVFDPLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCL
LRFEFSLDPSRLPIKMPQLVLCSKNGFHLHLKPLGPGSGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccctctctctcccatcccttccccagggagaggcctgctggttcttgagggg
cccaagtggttgcagcaccgcaagctgctcacacctggctttcattatgatgtgctgaag
ccctatgtggccgtgttcactgagtctacacgtatcatgctggacaagtgggaagagaaa
gctcgggagggtaagtcctttgacatcttctgcgatgtgggtcacatggcgctgaacaca
ctcatgaagtgcacctttggaagaggagacaccggcctgggccacagggacagcagctac
taccttgcagtcagcgatctcactctgttgatgcagcagcgccttgtgtccttccagtac
cataatgacttcatctactggctcaccccacatggccgccgcttcctgcgggcctgccag
gtggcccatgaccatacagaccaggtcatcagggagcggaaggcagccctgcaggatgag
aaggtgcagaagaagatccagaaccggaggcacctggacttcctggacattctcctgggt
gcctgggatgaagatgacatcaaactgtcagatgcagacctccgggctgaagtggacaca
ttcatgtttgaaggccatgacaccaccaccagtggtatctcctggtttctctactgcatg
gccctgtaccctgagcaccagcatcgttgtagagaggaggtccgtgagatcctaggggac
caggactccttccagtgggatgatctgggcaagatgacttatctgaccatgtgcatcaag
gagagcttccgcctctacccacctgtgccccaggtgtaccgccagctcagcaagcctgtc
acctttgtggatggccggtctctacctgcaggaagcctgatctctatgcatatctatgcc
ctccataggaacagtgctgtatggcccgaccctgaggtctttgaccctctgcgcttttcc
actgagaatgcatccaaacgccatccctttgcctttatgcccttctctgctgggcccagg
aactgcattgggcagcagtttgccatgagtgagatgaaggtggtcacagccatgtgcttg
ctccgctttgagttctctctggacccctcacggctgcccatcaagatgccccagcttgtc
ctgtgctccaagaatggctttcacctccacctgaagccactgggccctgggtctgggaag
tag

DBGET integrated database retrieval system