KEGG   Pan troglodytes (chimpanzee): 456557Help
Entry
456557            CDS       T01005                                 

Gene name
CYP4B1
Definition
(RefSeq) cytochrome P450 family 4 subfamily B member 1
  KO
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     456557 (CYP4B1)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP4 family
   456557 (CYP4B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 512 aa AA seqDB search
MVPSFLSLSFSSLGLRASGLILVLGFLKLIRLLLRRQMLAKAMDNFPGPPTHWLFGHALE
IQETGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAQAVYSRGDPKAPDVYDFFLQ
WIGRGLLVLEGPKWLQHRKLLTPGFHYDVLKPYVAVFTESTRIMLDKWEEKAREGKSFDI
FCDVGHMALNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHNDFIYWL
TPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVQKKIQNRRHLDFLDILLGAWDEDDIK
LSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDSFQWDD
LGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVW
PDPEVFDPLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLD
PSRLPIKMPQLVLCSKNGFHLHLKPLGPGSGK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccagcttcctctccctgagcttctcctccttgggcctgcgggcttctgggctg
atcttggtcttaggctttctcaagctcatccgcctgctgctgcggaggcagatgttggct
aaggctatggacaacttcccagggcctcccacccactggctctttggacatgccctcgag
atccaggagacggggagcctcgacaaagtggtgtcctgggcccaccagttcccatatgcc
cacccactctggttcggacagttcattggcttcctgaacatctatgagcctgactatgcc
caagctgtgtacagccgtggggaccctaaggcccctgatgtgtatgacttcttcctccag
tggattgggagaggcctgctggttcttgaggggcccaagtggttgcagcaccgcaagctg
ctcacacctggctttcattatgatgtgctgaagccctatgtggccgtgttcactgagtct
acacgtatcatgctggacaagtgggaagagaaagctcgggagggtaagtcctttgacatc
ttctgcgatgtgggtcacatggcgctgaacacactcatgaagtgcacctttggaagagga
gacaccggcctgggccacagcagggacagcagctactaccttgcagtcagcgatctcact
ctgttgatgcagcagcgccttgtgtccttccagtaccataatgacttcatctactggctc
accccacatggccgccgcttcctgcgggcctgccaggtggcccatgaccatacagaccag
gtcatcagggagcggaaggcagccctgcaggatgagaaggtgcagaagaagatccagaac
cggaggcacctggacttcctggacattctcctgggtgcctgggatgaagatgacatcaaa
ctgtcagatgcagacctccgggctgaagtggacacattcatgtttgaaggccatgacacc
accaccagtggtatctcctggtttctctactgcatggccctgtaccctgagcaccagcat
cgttgtagagaggaggtccgtgagatcctaggggaccaggactccttccagtgggatgat
ctgggcaagatgacttatctgaccatgtgcatcaaggagagcttccgcctctacccacct
gtgccccaggtgtaccgccagctcagcaagcctgtcacctttgtggatggccggtctcta
cctgcaggaagcctgatctctatgcatatctatgccctccataggaacagtgctgtatgg
cccgaccctgaggtctttgaccctctgcgcttttccactgagaatgcatccaaacgccat
ccctttgcctttatgcccttctctgctgggcccaggaactgcattgggcagcagtttgcc
atgagtgagatgaaggtggtcacagccatgtgcttgctccgctttgagttctctctggac
ccctcacggctgcccatcaagatgccccagcttgtcctgtgctccaagaatggctttcac
ctccacctgaagccactgggccctgggtctgggaagtag

DBGET integrated database retrieval system