KEGG   Pan troglodytes (chimpanzee): 456602Help
Entry
456602            CDS       T01005                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     456602 (USP48)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   456602 (USP48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 983 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAAVKGNDGFWVGKSSLR
SWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCIS
ENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTSL
PNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGG
LMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEMGDVNPSETQYISEPKL
CPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPD
GEKDPDFNQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYA
AMDDVMQVCMPEEGFKGTGLLGH
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggccccacggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgagaccgcttaccgcatctggctggagccctgcatt
cgcggcgtgtgcagacgaaactgcaaaggaaatccgaattgcttggttggtattggtgag
catatttggttaggagaaatagatgaaaatagttttcataacatcgatgatcccaactgt
gagaggagaaaaaagaactcatttgtgggcctgactaaccttggagccacttgttatgtc
aacacatttcttcaagtgtggtttctcaacttggagcttcggcaggcactctacttatgt
ccaagcacttgtagtgactacatgctgggagacggcatccaagaagaaaaagattatgag
cctcaaacaatttgtgagcatctccagtacttgtttgccttgttgcaaaacagtaatagg
cgatacattgatccatcaggatttgttaaagccttgggcctggacactggacaacagcag
gatgctcaagaattttcaaagctctttatgtctctattggaagatactttgtctaaacaa
aagaatccagatgtgcgcaatattgttcaacagcagttctgtggagaatatgcctatgta
actgtttgcaaccagtgtggcagagagtctaagcttttgtcaaaattttatgagctggag
ttaaatatccaaggccacaaacagttaacggattgtatctcggaatttttgaaggaagaa
aaattagaaggagacaatcgctatttttgcgagaactgtcaaagcaaacagaatgcaaca
agaaagattcgacttcttagccttccttgcactctgaacttgcagctaatgcgttttgtc
tttgacaggcaaactggacataagaaaaagctgaatacctacattggcttctcggaaatt
ttggatatggagccttatgtggaacataaaggtgggtcctacgtgtatgaactcagcgca
gtcctcatacacagaggagtgagtgcttattctggccactacattgcccacgtgaaagat
ccacagtctggtgaatggtataagtttaatgatgaagacatagaaaagatggaggggaag
aaattacaactagggattgaggaagatctagcagaaccttctaagtctcagacacgtaaa
cccaagtgtggcaaaggaactcattgctctcgaaatgcatatatgttggtttatagactg
caaactcaagaaaagcccaacactactgttcaagttccagcctttcttcaagagctggta
gatcgggataattccaaatttgaggagtggtgtattgaaatggctgagatgcgtaagcaa
agtgtggataaaggaaaagcaaaacacgaagaggttaaggagctgtaccaaaggttacct
gctggagctgagccctatgagtttgtctctctggaatggctgcaaaagtggttggatgaa
tcaacacctaccaaacctattgataatcacgcttgcctgtgttcccatgacaagcttcac
ccggataaaatatcaattatgaagaggatatctgaatatgcagctgacattttctatagt
agatatggaggaggtccaagactaactgtgaaagccctgtgtaaggaatgtgtagtagaa
cgttgtcgcatattgcgtctgaagaaccaactaaatgaagattataaaactgttaataat
ctgctgaaagcagcagtaaagggcaacgatggattttgggtggggaagtcttccttgcgg
agttggcgccagctagctcttgaacagctggatgagcaagatggtgatgcagaacaaagc
aacggaaagatgaacggtagcaccttaaataaagatgaatcaaaggaagaaagaaaagaa
gaggaggaattaaattttaatgaagatattctgtgtccacatggtgagttatgcatatct
gaaaatgaaagaaggcttgtttctaaagaggcttggagcaaactgcagcagtactttcca
aaggctcctgagtttccaagttacaaagagtgctgttcacagtgcaagattttagaaaga
gaaggggaagaaaatgaagccttacataagatgattgcaaacgagcaaaagacttctctc
ccaaatttgttccaggataaaaacagaccgtgtctcagtaactggccagaggatacggat
gtcctctacatcgtgtctcagttctttgtagaagagtggcggaaatttgttagaaagcct
acaagatgcagccctgtgtcatcagttgggaacagtgctcttttgtgtccccacgggggc
ctcatgtttacatttgcttccatgaccaaagaagattctaaacttatagctctcatatgg
cccagtgagtggcaaatgatacaaaagctctttgttgtggatcatgtaattaaaatcacg
agaattgaaatgggagatgtaaacccttcagaaacacagtatatttctgagcccaaactc
tgtccagaatgcagagaaggcttattgtgtcagcagcagagggacctgcgtgaatacact
caagccaccatctatgtccataaagttgtggataacaaaaaggtgatgaaggattcggct
ccggaactgaatgtgagtagttctgaaacagaggaggacaaggaagaagctaaaccagat
ggagaaaaagatccagattttaatcaaatcatgcatgcattttcagttgctccttttgac
cagaatttgtcaattgatggaaagattttaagtgatgactgtgccaccctaggcaccctt
ggcgtcattcctgaatctgtcattttattgaaggctgatgaaccaattgcagattatgct
gcaatggatgatgtcatgcaagtttgtatgccagaagaagggtttaaaggtactggtctt
cttggacattaa

DBGET integrated database retrieval system