KEGG   Pan troglodytes (chimpanzee): 456680Help
Entry
456680            CDS       T01005                                 

Gene name
RPA2
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:ptr03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ptr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ptr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ptr03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:ptr03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 269 aa AA seqDB search
MWNSGFENYGSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVD
EVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVP
PETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRA
PISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSS
IKQAVDFLSNEGHIYSTVDDDHFKSTDAE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacagtggattcgaaaactatggcagctcatacgggggagccggcggctacacg
cagtccccggggggctttggatcgcctgcaccttctcaagccgaaaagaaatcaagagcc
cgagcccagcacattgtgccctgtactatatctcagctgctttctgccactttggttgat
gaagtgttcagaattgggaatgttgagatttcacaggtcactattgtggggatcatcaga
catgcagagaaggctccaaccaacattgtttacaaaatagatgacatgacagctgcaccc
atggacgttcgccagtgggttgacacagatgacaccagcagtgaaaacactgtggttcct
ccagaaacatatgtgaaagtggcaggccacctgagatcttttcagaacaaaaagagcctg
gtagcctttaagatcatgcccctggaggatatgaatgagttcaccacacatattctggaa
gtgatcaatgcacacatggtactaagcaaagccaacagccagccctcagcagggagagca
cctatcagcaatccaggaatgagtgaagcagggaactttggtgggaatagcttcatgcca
gcaaatggcctcactgtggcccaaaaccaggtgttgaatttgattaaggcttgtccaaga
cctgaagggttgaactttcaggatctcaagaaccagctgaaacacatgtctgtatcctca
atcaagcaagctgtggattttctgagcaatgaggggcacatctattctactgtggatgat
gaccattttaaatccacagatgcagaataa

DBGET integrated database retrieval system