KEGG   Pan troglodytes (chimpanzee): 456881Help
Entry
456881            CDS       T01005                                 

Gene name
USP24
Definition
(RefSeq) ubiquitin specific peptidase 24
  KO
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     456881 (USP24)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   456881 (USP24)
Ubiquitin system [BR:ptr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    456881 (USP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2619 aa AA seqDB search
MESEEEQHMTTLLCMGFSDPATIRKALRLAKNDINEAVALLTNERPGLDYGGYEPMDSGG
GPSPGPGGGPRGDGGGDGGGGPSRGGSTGGGGGFDPPPAYHEVVDAEKNDENGNCSGEGI
EFPTTNLYELESRVLTDHWSIPYKREESLGKCLLASTYLARLGLSESDENCRRFMDRCMP
EAFKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAERIKQDPIPIGLLGVLTMAFNPDNE
YHFKNRMKVSQRNWAEVFGEGNMFAVSPVSTFQKEPHGWVVDLVNKFGELGGFAAIQAKL
HSEDIELGAVSALIQPLGVCAEYLNSSVVQPMLDPVILTTIQDVRSVEEKDLKDKRLVSI
PELLSAVKLLCMRFQPDLVTIVDDLRLDILLRMLKSPHFSAKMNSLKEVTKLIEDSTLSK
SVKNAIDTDRLLDWLVENSVLSIALEGNIDQAQYCDRIKGIIELLGSKLSLDELTKIWKI
QSGQSSTVIENIHTIIAAAAVKFNSDQLNHLFVLIQKSWETESDRVRQKLLSLIGRIGRE
ARFETTSGKVLDVLWELAHLPTLPSSLIQQALEEHLTILSDAYAVKEAIKRSYIIKCIED
IKRPGEWSGLEKNKKDGFKSSQLNNPQFVWVVPALRQLHEITRSFIKQTYQKQDKSIIQD
LKKNFEIVKLVTGSLIACHRLAAAVAGPGGLSGSTLVDGRYTYREYLEAHLKFLAFFLQE
ATLYLGWNRAKEIWECLVTGQDVCELDREMCFEWFTKGQHDLESDVQQQLFKEKILKLES
YEITMNGFNLFKTFFENVNLCDHRLKRQGAQLYVEKLELIGMDFIWKIAMESPDEEIANE
AIQLIINYSYINLNPRLKKDSVSLHKKFIADCYTRLEAASSALGGPTLTHAVTRATKMLT
ATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVITIEDFYSVPRTILPHGASFHGHLLT
LNVTYESTKDTFTVEAHSNETIGSVRWKIAKQLCSPVDNIQIFTNDSLLTVNKDQKLLHQ
LGFSDEQILTVKTSGSGTPSGSSADSSTSSSSSSSGVFSSSYAMEQEKSLPGVVMALVCN
VFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEALDQLDSLGRKKTLLSESSSQSSKS
PSLSSKQQHQPSASSILESLFRSFAPGMSTFRVLYNLEVLSSKLMPTADDDMARSCAKSF
CENFLKAGGLSLVVNVMQRDSIPSEVDYETRQGVYSICLQLARFLLVGQTMPTLLDEDLT
KDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQLSVSDRSSIRVEEIIPAARVAIQT
MEVSDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKESNSLCPAGIRNRLSSSGSNCSSGS
EGEPVALHAGICVRQQSVSTKDSLIAGEALSLLVTCLQLRSQQLASFYNLPCVADFIIDI
LLGSPSAEIRRVACDQLYTLSQTDTSAHPDVQKPNQFLLGVILTAQLPLWSPTSIMRGVN
QRLLSQCMEYFDLRCQLLDDLTTSEMEQLRISPATMLEDEITWLDNFEPNRTAECETSEA
DNILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLDDFLFRASRIILNSHSPAGSAAISQ
QDFHPKCSTANSRLAAYEVLVMLADSSPSNLQIIIKELLSMHHQPDPALTKEFDYLPPVD
SRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESLLSVDDDTDNPDDSVFYQVQSLFGH
LMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLIDQMDEYLKKMGRDQIFKNT
FQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQSLEISLDQFVRGEVLEGSNAYYCEK
CKEKRITVKRTCIKSLPSVLVIHLMRFGFDWESGRSIKYDEQIRFPWMLNMEPYTVSGMA
RQDSSSEVGENGRSVDQGGGGSPRKKVALTENYELVGVIVHSGQAHAGHYYSFIKDRRGC
GKGKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKVYDQTNPYTDVRRRYWNAYMLFYQR
VSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEISPQSSPRPHRPNNDRLSILTKLVKK
GEKKGLFVEKMPARIYQMVRDENLKFMKNRDVYSSDYFSFVLSLASLNATKLKHPYYPCM
AKVSLQLAIQFLFQTYLRTKKKLRVDTEEWIATIEALLSKSFDACQWLVEYFISSEGREL
IKIFLLECNVREVRVAVATILEKTLDSALFYQDKLKSLHQLLEVLLALLDKDVPENCKNC
AQYFFLFNTFVQKQGIRAGDLLLRHSALRHMISFLLGASRQNNQIRRWSSAQAREFGNLH
NTVALLVLHSDVSSQRNVAPGVFKQRPPISIAPSSPLLPLHEEVEALLFMSEGKPYLLEV
MFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFIKNQLETAPPHELKNTFQLLHEILV
IEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCYQCVKFLVTLAQKCPAAKEYFKENS
HHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGS
SNGSESSPANENGDRHLQQGSESPMMIGELRSDLDDVDP
NT seq 7860 nt NT seq  +upstreamnt  +downstreamnt
atggaatcggaggaggagcagcacatgaccacgctgctgtgcatgggcttctcggacccc
gccaccatccgcaaggccctgcgcctggccaagaacgacatcaacgaggccgtggcactg
ctcaccaacgagcggccgggcctcgactacggcggctacgagcccatggacagcggcggt
ggccccagccccgggcccggcgggggcccgcggggcgacggcggaggtgacggcggcggc
ggcccctcccgcggcgggagcaccggaggcgggggcggcttcgaccccccgcccgcctac
cacgaggtggtggacgcggagaagaatgatgagaatggaaactgctcaggggaaggaatt
gaattccctacaacaaatttatatgaactggaaagccgtgttttgactgatcattggtcc
atcccttacaagcgagaagaatcactaggcaaatgcctgttggcatctacctacctagca
agacttggtctttccgagtctgatgagaactgtagaaggtttatggataggtgtatgcct
gaagcatttaaaaagctcctgacatcaagtgctgtccacaagtggggtactgaaattcat
gaaggaatttacaacatgttgatgctattaatagaactggtcgcagagagaataaaacaa
gatccaattcccattggtctcctgggtgtgcttacaatggctttcaatcctgataatgaa
taccattttaaaaacagaatgaaagtgtctcaaaggaattgggcagaagtgtttggagag
ggaaatatgtttgctgtttcacctgtatcgactttccaaaaggagcctcatggatgggtt
gtggatttggtaaataagttcggagaattaggtggatttgcagcaatccaagccaagctc
cattcagaagatatagaacttggggctgtctcagcactgattcagcccttaggagtgtgt
gcagagtacctcaattcctccgtggtacagcccatgctagacccagtcattcttactaca
atccaggatgtacggagtgtagaagagaaagacctcaaagacaagagattggttagcatc
cctgagctcttgtctgctgttaagttactttgcatgcgcttccaaccggatctggtgaca
attgtggatgaccttcgactagatattctattgcgcatgctgaaatcaccacatttcagt
gctaagatgaattctctcaaagaagtaaccaagctaatagaagatagcactttatccaaa
tctgtgaagaatgctatagatacagacagattattagattggctagttgaaaactcagtt
ctgtcgattgcactggaaggcaacatagaccaagcacaatactgtgaccgtataaaggga
attattgaactcttgggtagtaaattgtcgttagatgaactcactaaaatttggaagata
cagtcaggacaatcatctactgtgattgagaacattcatactattattgctgcagcggct
gtgaaatttaattcagatcagcttaatcatttgtttgttctcattcagaagagctgggag
actgagagtgatagagtaagacagaagcttttgagcctgattggacgaataggccgggaa
gctcgctttgagaccacttctggaaaggttttagacgtactctgggaactggctcacctt
ccaaccctgcccagtagccttattcagcaggccttggaggagcacctgacaatccttagt
gatgcatatgcagtgaaagaagcgatcaagaggagctacatcatcaagtgcatagaagat
attaagaggcctggagaatggtcaggtttggaaaaaaacaagaaggatggattcaagtca
tctcagcttaataatccccagtttgtatgggtggtaccagctttgcgtcagctccatgaa
attactcgctcattcataaaacaaacctatcaaaagcaagacaagagcattattcaagac
ttgaagaagaattttgaaatagtgaaattggtaacgggaagtttgatcgcttgtcatcgg
cttgcagctgctgtggccgggcctggaggcttaagtggctcgacactagtggatggccgg
tacacttaccgggagtatttagaggcacatctaaaatttctagcgtttttcttgcaagaa
gctactctgtatctgggctggaatcgtgccaaggagatctgggagtgtcttgtaactggc
caggatgtttgtgaattagatagagagatgtgttttgaatggtttacaaaaggacagcat
gatcttgagagtgatgttcagcagcagctcttcaaggagaaaattcttaaattggagtca
tatgaaatcactatgaatggttttaacttatttaaaactttttttgaaaatgtgaatctt
tgtgatcatcgattgaaaagacaaggagctcagttgtatgtagaaaagctggaattgata
ggaatggatttcatttggaaaatagccatggaatcacctgatgaagaaattgctaatgaa
gctattcagctaatcataaactatagttacattaatctaaatcctagattaaagaaggat
tcagtatctttacataagaaattcattgctgattgctacacaagattagaagcagccagt
tcagcacttggtggccccactctaacacatgctgtgaccagagcaacaaaaatgcttaca
gcaactgccatgccaactgtagcaacctcagttcagtctccttatagatccactaaactt
gtaataattgagagattgctgcttctggcagagcgctatgtgatcactatagaggatttt
tactctgttccacgaactattctacctcatggtgcctcatttcatggacatcttttaact
cttaatgttacctatgagtctaccaaagataccttcactgtcgaggctcacagtaatgaa
accatagggagtgtccggtggaaaatagccaagcagttgtgctctcctgtggataatata
cagatatttacaaatgatagcctgctgacagtgaataaagatcaaaagctactccaccaa
ctgggcttttctgatgaacaaatccttacagtgaagacttctggcagtgggaccccatct
gggagttcagcagattcttcaaccagctccagcagcagcagcagtggggtttttagttct
tcatatgccatggagcaggagaaatccctccctggtgtagtgatggctctcgtatgtaat
gtatttgacatgctttatcagctcgccaatctggaagagccaaggataactctacgagta
cggaagcttctgctcttgatacccactgatccagccattcaggaagcccttgatcaactt
gattctttaggaagaaagaaaacattgctgtctgaatcaagttctcagtcctcaaaatct
ccatccctgtcatcaaagcaacagcaccagccaagtgccagttcaattttagaaagtctg
tttcgatcttttgccccgggaatgtctaccttcagagtgctctacaacttagaagttcta
agctccaaactcatgccaacagctgatgatgacatggccagaagctgtgccaaatccttc
tgtgaaaacttcctcaaagctggcggtttgagtttggttgtaaatgtcatgcagagagac
tccatcccatcagaagtagactatgaaacaaggcagggtgtttattccatctgtctacag
cttgcaagatttttacttgtcggacaaacaatgcccacgttattagatgaagacctcacc
aaagatggcatagaagcactttcttcccgcccattccgaaatgtcagccggcagacaagc
agacagatgtccttatgtggtaccccagaaaagtcatcctaccgacagttgtccgtgtct
gataggtcttctattagggttgaggaaatcatccctgctgctcgagttgcaatacaaaca
atggaagtaagtgatttcacttctactgtggcttgcttcatgagattgtcatgggctgcg
gctgcaggacggcttgatcttgttgggagtagccagccaattaaagaaagtaattccctg
tgtcctgctggaattcgaaacagactcagcagttcaggaagcaattgcagctctggaagt
gaaggagaaccagtagccctgcatgcaggaatctgtgttcgacaacagtctgtatccacc
aaagactctctgattgcgggagaggctttgtctcttctcgttacgtgcctacagcttcgg
agccagcaactggcatctttctataacttgccctgtgttgctgatttcatcattgatatt
ctgctcggatcaccaagtgctgagattcgccgggttgcctgtgatcagctgtacactctt
agtcagacagacacatcagcgcatccagatgtgcagaagccaaatcagtttcttctaggc
gtaatcctcacggctcagctgcctctctggtctccaactagtattatgagaggagtcaat
cagagactgttatctcagtgtatggagtattttgatttgagatgccagttattagatgat
ctgacaacttcagaaatggagcagttaaggatcagcccagctacgatgcttgaagatgag
attacttggctggataactttgaacctaatcgtacagctgaatgtgagaccagtgaagcg
gacaacatcttactggcagggcacttacgcctcatcaagacccttctttcactctgtggg
gcagaaaaggaaatgcttggttcatcactcattaaaccattgttagatgacttccttttc
cgagcttctagaattattttaaatagtcattctccagctggcagtgccgccatcagtcaa
caggactttcatccaaagtgtagtacagcgaatagccgattggcagcctatgaagtcctt
gtgatgttggctgatagttcaccttcaaatcttcaaattattataaaagaactgctttct
atgcatcaccaacctgaccctgctcttaccaaggagtttgattaccttcccccagtggat
agcaggtccagttcagggtttgtggggctgagaaatggtggtgcaacttgttatatgaat
gcagtcttccagcagctgtatatgcaacctgggctccctgagtcattactttcagtggat
gatgacacagacaatccagatgatagtgtgttttaccaagtgcagtctctctttgggcat
ttaatggaaagcaagctgcagtactatgtacctgagaatttttggaagattttcaagatg
tggaataaagaactttatgtgagagaacagcaggatgcatatgaattctttactagtctc
attgatcagatggatgaatacctcaagaaaatggggagagaccaaatttttaagaataca
tttcagggcatctactctgatcagaagatctgtaaagactgtcctcacagatatgagcgt
gaagaagctttcatggctctcaatctaggagtgacttcttgtcagagtttggaaatttct
ttggaccaatttgttagaggagaagttctagaaggaagtaatgcgtactactgtgaaaag
tgtaaagaaaagagaataacagtgaaaaggacctgtattaaatctttacctagcgtcttg
gtaattcacctaatgagatttgggtttgactgggaaagcggacgctccattaaatatgat
gaacaaataaggtttccctggatgctaaacatggagccttacacagtttcaggaatggct
cgccaagattcttcttctgaagttggggaaaatgggcgaagtgtggatcagggaggtgga
ggatccccacgaaaaaaggttgccctcacagaaaactatgaacttgtcggtgtcatcgta
cacagtgggcaggcacacgcaggccactactattccttcattaaggacaggcgagggtgt
ggaaaaggaaagtggtataaatttaatgacacagttatagaagaatttgacctaaatgat
gagaccctggagtatgaatgctttggaggagaatatagaccaaaagtttatgatcaaaca
aacccatacactgatgtgcgccgaagatactggaatgcctatatgcttttctaccaaagg
gtgtctgatcagaactccccagtattaccaaagaaaagtcgagtcagtgttgtacggcag
gaagctgaggatctctctctgtcagctccatcttcaccagaaatttcacctcagtcatcc
cctcggccccataggccgaacaatgaccggctgtctattcttaccaagctggttaaaaaa
ggcgagaagaaaggactgtttgtggagaaaatgcctgctcgaatataccagatggtgaga
gatgagaacctcaagtttatgaagaatagagatgtgtacagtagtgattatttcagtttt
gttttgtctttagcttcgttgaatgctactaaattaaagcatccatattatccttgcatg
gcaaaggtgagcttacagcttgctattcaattcctttttcaaacttatctacggacaaag
aagaaactcagggttgatactgaagaatggattgctaccattgaagcattgctttcaaaa
agttttgatgcttgtcagtggttagttgaatattttattagttctgaaggacgagaattg
ataaagattttcttactggagtgcaatgtgagagaagtacgagttgctgtggccaccatt
ctggagaaaaccctagacagtgccttgttttatcaggataagttaaaaagccttcatcag
ttactggaggtactacttgctctgttggacaaagacgtcccagaaaattgtaaaaactgt
gctcagtactttttcctgttcaacacttttgtacaaaagcaaggaattagggctggagat
cttcttctgaggcattcagctctgcggcacatgatcagcttcctcctaggggccagtcgg
caaaacaatcagatacgtcgatggagttcagcacaagcacgagaatttgggaatcttcac
aatacagtggcgttacttgttttgcattcagatgtctcatcccaaaggaatgttgctcct
ggcgtatttaagcaacgaccacccattagcattgctccctcaagccctctgctgcccctc
catgaggaggtagaagccttgttgttcatgtctgaagggaaaccttacctgttagaggta
atgtttgctttgcgggagctgacaggctcgctcttggcactcattgagatggtagtgtac
tgctgtttctgtaatgagcatttttccttcacaatgctgcatttcattaagaaccaacta
gaaacggctccacctcatgagttaaagaatacgttccaactacttcatgaaatattggtt
attgaagatcccatacaagtagagcgagtcaaatttgtgtttgagacagaaaatggatta
ctagctttgatgcaccacagtaatcatgtggacagtagtcgctgctaccagtgtgtcaaa
tttcttgtcactcttgctcaaaagtgtcctgcagctaaggagtacttcaaggagaattcc
caccactggagctgggctgtgcagtggctacagaagaagatgtcagaacattactggaca
ccacagagtaatgtctctaatgaaacatcaactggaaaaacctttcagcgaaccatttca
gctcaggacacgttagcgtatgccacagctttgttgaatgaaaaagagcaatcaggaagc
agtaatgggtcggagagtagtcctgccaatgagaacggagacaggcatctacagcagggt
tcagaatctcccatgatgattggtgagttgagaagtgaccttgatgatgttgatccctag

DBGET integrated database retrieval system