KEGG   Pan troglodytes (chimpanzee): 456965Help
Entry
456965            CDS       T01005                                 

Gene name
USP33
Definition
ubiquitin specific peptidase 33
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     456965 (USP33)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   456965 (USP33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 942 aa AA seqDB search
MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSHGT
CQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKE
VFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELR
ARGLTGLKNIGNTCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELW
HKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQT
ITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMS
KDWQKEKMCNKINKVNSEGEFDKDRDSISQTVDLNNQETVKVQIHSRASEYITDVHSNDL
STPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYRSVISDIFD
GTIISSVQCLTCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQ
GWIAFFMEYVKRFVVSCVPSWFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGV
KFCKVQKFPEILCIHLKRFRHELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLL
SVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQ
KERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGGVPPRKAGYIE
DLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQK
EDSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEE
TWNFLQSIYGGGPEVILRPPVVHVDPDILQAEEKIEVETRSL
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgacaggatcaaattcacacataacgatattaaccttaaaggtgttacctcattttgaa
agtcttgggaaacaggaaaaaattcctaacaaaatgtcagcttttcgaaatcattgtcca
catttggattcagttggtgaaataacaaaagaagatttgatacaaaaatcccatggtact
tgtcaggattgtaaagtccaaggaccaaatctttgggcatgtctggagaatagatgttca
tatgttggctgtggtgaatcacaagtagatcacagcaccatacattctcaggagacaaag
cattatctaactgtgaaccttaccactcttcgagtatggtgttatgcttgcagcaaagaa
gtatttttggataggaaattaggaactcagccttcattgcctcatgtaagacaacctcac
caaatacaagaaaacagtgtccaggattttaaaatacccagtaatacaacattaaaaact
cctctggttgccgtatttgatgatctggatatagaagcggatgaagaagatgaacttagg
gcaagaggtcttacaggtttgaaaaatattggaaatacttgttacatgaatgcagctttg
caggctctttctaattgcccacctttgacacagttttttcttgattgtggaggactagct
cgaacagataagaaacctgccatttgtaaaagttatctcaaactaatgacagagctgtgg
cataaaagcaggccaggatctgttgtgcctactactctgtttcaaggaattaaaactgta
aatccaacatttcgggggtattctcagcaggatgctcaagaattccttcgatgtttaatg
gatctgcttcatgaagaattgaaagagcaagtcatggaagtagaagaagatccgcaaacc
ataaccactgaggagacaatggaagaagacaagagccagtcggatgtagattttcagtct
tgtgaatcttgtagcaacagtgatagagcagaaaatgaaaatggctctagatgcttttct
gaagataataatgaaacaacaatgttaattcaggatgatgaaaacaattcagaaatgtca
aaagattggcaaaaagagaagatgtgcaataagattaataaagtaaattctgaaggcgaa
tttgataaagatagagactctatatctcaaacagtcgacttaaacaaccaggaaactgtc
aaagtgcaaatacacagcagagcttcagagtatatcactgatgtccattcgaatgacctg
tctacaccacagatccttccatcaaatgaaggtgttaatccacgtttatcggcaagccct
cctaaatcaggcaatttgtggccaggattggcaccaccacacaaaaaagctcagtctgca
tctccaaagagaaaaaaacagcacaagaaatacagaagtgttatttcagacatatttgat
ggaacaatcattagttcagtgcagtgtctgacttgtgacagggtgtctgtaaccctcgag
acctttcaagatctgtccttgccaattcctggcaaggaagaccttgctaagctgcattca
tcaagtcatccaacttctatagtcaaagcaggatcatgtggcgaagcatatgctccacaa
gggtggatagcttttttcatggaatatgtgaagaggtttgttgtctcatgtgtccctagc
tggttttggggtccagtagtaaccttgcaagattgtcttgctgccttctttgccagagat
gaactaaaaggtgacaatatgtacagttgtgaaaaatgcaaaaagttgagaaatggagtg
aagttttgtaaagtacaaaagtttcctgagattttatgcatccaccttaaaagattcaga
catgaactaatgttttccaccaaaatcagtacccatgtttcatttccgctagaaggcttg
gatcttcagccatttcttgctaaggatagtccagctcaaattgtgacatatgatcttctg
tcagtcatttgccatcatggaactgcaagtagtggacactatatagcctactgccgaaac
aatctaaataatctctggtatgaatttgatgatcagagtgtcactgaagtttcagaatct
actgtacaaaatgcagaagcttacgttcttttctataggaagagcagcgaagaggcacaa
aaagagaggagaaggatatcaaatttattgaacataatggaaccaagcctccttcagttt
tatatttctcgacagtggcttaataaatttaagacctttgccgaacctggccctatttca
aataatgactttctttgtattcatggaggtgttcctccaagaaaagctggttatattgaa
gacctggttttgatgctgcctcagaacatttgggataacctatatagcaggtatggtgga
ggaccagctgtcaaccatctgtacatttgtcatacttgccaaattgaggcggaaaaaatt
gaaaaaagaagaaaaactgaattggaaatttttattcggcttaacagagcgttccaaaaa
gaggactctccagctactttttattgcatcagtatgcagtggtttagagaatgggaaagt
tttgtgaagggtaaagatggagatcctccaggtcctattgacaatactaagattgcagtc
actaaatgtggtaatgtgatgcttaggcaaggagcagattctggccagatttctgaagaa
acatggaattttctgcagtctatttatggtggagggcctgaagttatcctacgacctccg
gttgttcatgttgatccagatatacttcaagcagaagaaaaaattgaagtagaaactcgg
tctttgtaa

DBGET integrated database retrieval system