KEGG   Pan troglodytes (chimpanzee): 457476Help
Entry
457476            CDS       T01005                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X2
  KO
K08526  retinoid X receptor gamma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03320  PPAR signaling pathway
ptr04659  Th17 cell differentiation
ptr04919  Thyroid hormone signaling pathway
ptr04920  Adipocytokine signaling pathway
ptr04928  Parathyroid hormone synthesis, secretion and action
ptr05200  Pathways in cancer
ptr05202  Transcriptional misregulation in cancer
ptr05216  Thyroid cancer
ptr05222  Small cell lung cancer
ptr05223  Non-small cell lung cancer
ptr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    457476 (RXRG)
  Endocrine system
   04920 Adipocytokine signaling pathway
    457476 (RXRG)
   03320 PPAR signaling pathway
    457476 (RXRG)
   04919 Thyroid hormone signaling pathway
    457476 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    457476 (RXRG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    457476 (RXRG)
   05202 Transcriptional misregulation in cancers
    457476 (RXRG)
   05226 Gastric cancer
    457476 (RXRG)
   05216 Thyroid cancer
    457476 (RXRG)
   05222 Small cell lung cancer
    457476 (RXRG)
   05223 Non-small cell lung cancer
    457476 (RXRG)
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    457476 (RXRG)
Nuclear receptors [BR:ptr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   457476 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 457476
NCBI-ProteinID: XP_003949681
Ensembl: ENSPTRG00000023788
UniProt: A0A2I3T4S3
Position
1
AA seq 340 aa AA seqDB search
MNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLI
DKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERILEAE
LAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLR
AGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQM
DKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaactacccatccaccagccccggatctctggttaaacacatctgtgccatctgtgga
gacagatcctcaggaaagcactacggggtatacagttgtgaaggctgcaaagggttcttc
aagaggacgataaggaaggacctcatctacacgtgtcgggataataaagactgcctcatt
gacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgccttgtcatgggc
atgaagagggaagctgtgcaagaagaaagacagaggagccgagagcgagctgagagtgag
gcagaatgtgctaccagtggtcatgaagacatgcctgtggagaggattctagaagctgaa
cttgctgttgaaccaaagacagaatcctatggtgacatgaatatggagaactcgacaaat
gaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctcgttgaatgg
gccaagcgtattccccacttctctgacctcaccttggaggaccaggtcattttgcttcgg
gcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttccgtgcaggat
ggcatccttctggccacgggtttacatgtccaccggagcagtgcccacagtgctggggtc
ggctccatctttgacagagttctaactgagctggtttccaaaatgaaagacatgcagatg
gacaagtcggagctgggatgcctgcgagccattgtgctctttaacccagatgccaagggc
ctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccacccttgaggcc
tacaccaagcagaagtatccggaacagccaggcaggtttgccaagctgctgctccgcctc
ccagctctgcgttccattggcttgaaatgcctggagcacctcttcttcttcaagctcatc
ggggacacccccattgacaccttcctcatggagatgttggagaccccgctgcagatcacc
tga

DBGET integrated database retrieval system