KEGG   Pan troglodytes (chimpanzee): 457476Help
Entry
457476            CDS       T01005                                 

Gene name
RXRG
Definition
retinoid X receptor, gamma
Orthology
K08526  
retinoid X receptor gamma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    457476 (RXRG)
   03320 PPAR signaling pathway
    457476 (RXRG)
   04919 Thyroid hormone signaling pathway
    457476 (RXRG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    457476 (RXRG)
   05202 Transcriptional misregulation in cancers
    457476 (RXRG)
   05216 Thyroid cancer
    457476 (RXRG)
   05222 Small cell lung cancer
    457476 (RXRG)
   05223 Non-small cell lung cancer
    457476 (RXRG)
Transcription factors [BR:ptr03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    457476 (RXRG)
Nuclear receptors [BR:ptr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   457476 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 340 aa AA seqDB search
MNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLI
DKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERILEAE
LAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLR
AGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQM
DKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaactacccatccaccagccccggatctctggttaaacacatctgtgccatctgtgga
gacagatcctcaggaaagcactacggggtatacagttgtgaaggctgcaaagggttcttc
aagaggacgataaggaaggacctcatctacacgtgtcgggataataaagactgcctcatt
gacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgccttgtcatgggc
atgaagagggaagctgtgcaagaagaaagacagaggagccgagagcgagctgagagtgag
gcagaatgtgctaccagtggtcatgaagacatgcctgtggagaggattctagaagctgaa
cttgctgttgaaccaaagacagaatcctatggtgacatgaatatggagaactcgacaaat
gaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctcgttgaatgg
gccaagcgtattccccacttctctgacctcaccttggaggaccaggtcattttgcttcgg
gcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttccgtgcaggat
ggcatccttctggccacgggtttacatgtccaccggagcagtgcccacagtgctggggtc
ggctccatctttgacagagttctaactgagctggtttccaaaatgaaagacatgcagatg
gacaagtcggagctgggatgcctgcgagccattgtgctctttaacccagatgccaagggc
ctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccacccttgaggcc
tacaccaagcagaagtatccggaacagccaggcaggtttgccaagctgctgctccgcctc
ccagctctgcgttccattggcttgaaatgcctggagcacctcttcttcttcaagctcatc
ggggacacccccattgacaccttcctcatggagatgttggagaccccgctgcagatcacc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system