KEGG   Pan troglodytes (chimpanzee): 457476Help
Entry
457476            CDS       T01005                                 

Gene name
RXRG
Definition
retinoid X receptor, gamma
Orthology
K08526  
retinoid X receptor gamma
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:ptr04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ptr03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ptr04919]
Human Diseases; Cancers; Pathways in cancer [PATH:ptr05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:ptr05202]
Human Diseases; Cancers; Thyroid cancer [PATH:ptr05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:ptr05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:ptr05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 340 aa AA seqDB search
MNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLI
DKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERILEAE
LAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLR
AGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQM
DKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaactacccatccaccagccccggatctctggttaaacacatctgtgccatctgtgga
gacagatcctcaggaaagcactacggggtatacagttgtgaaggctgcaaagggttcttc
aagaggacgataaggaaggacctcatctacacgtgtcgggataataaagactgcctcatt
gacaagcgtcagcgcaaccgctgccagtactgtcgctatcagaagtgccttgtcatgggc
atgaagagggaagctgtgcaagaagaaagacagaggagccgagagcgagctgagagtgag
gcagaatgtgctaccagtggtcatgaagacatgcctgtggagaggattctagaagctgaa
cttgctgttgaaccaaagacagaatcctatggtgacatgaatatggagaactcgacaaat
gaccctgttaccaacatatgtcatgctgctgacaagcagcttttcaccctcgttgaatgg
gccaagcgtattccccacttctctgacctcaccttggaggaccaggtcattttgcttcgg
gcagggtggaatgaattgctgattgcctctttctcccaccgctcagtttccgtgcaggat
ggcatccttctggccacgggtttacatgtccaccggagcagtgcccacagtgctggggtc
ggctccatctttgacagagttctaactgagctggtttccaaaatgaaagacatgcagatg
gacaagtcggagctgggatgcctgcgagccattgtgctctttaacccagatgccaagggc
ctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccacccttgaggcc
tacaccaagcagaagtatccggaacagccaggcaggtttgccaagctgctgctccgcctc
ccagctctgcgttccattggcttgaaatgcctggagcacctcttcttcttcaagctcatc
ggggacacccccattgacaccttcctcatggagatgttggagaccccgctgcagatcacc
tga

DBGET integrated database retrieval system