KEGG   Pan troglodytes (chimpanzee): 457570Help
Entry
457570            CDS       T01005                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    457570 (LAMC1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    457570 (LAMC1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    457570 (LAMC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    457570 (LAMC1)
   05222 Small cell lung cancer
    457570 (LAMC1)
  Neurodegenerative diseases
   05020 Prion diseases
    457570 (LAMC1)
  Infectious diseases
   05146 Amoebiasis
    457570 (LAMC1)
   05145 Toxoplasmosis
    457570 (LAMC1)
Cell adhesion molecules and their ligands [BR:ptr04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      457570 (LAMC1)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      457570 (LAMC1)
     Laminin-2 Extracellular matrix (ECM) components
      457570 (LAMC1)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      457570 (LAMC1)
   VLA-3
      457570 (LAMC1)
     Laminin-10 Extracellular matrix (ECM) components
      457570 (LAMC1)
     Laminin-11 Extracellular matrix (ECM) components
      457570 (LAMC1)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      457570 (LAMC1)
     Laminin-8 Extracellular matrix (ECM) components
      457570 (LAMC1)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      457570 (LAMC1)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      457570 (LAMC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 1609 aa AA seqDB search
MRGSHRAAPALWPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFN
VTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQS
QTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTLEDGPWIPYQYYSG
SCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVL
QEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEF
DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRS
TGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKP
GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPG
FFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRVEQRDGSEASLEW
SSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGA
GLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTY
SERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSP
CVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSS
CAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG
NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNPYGTMKQQSSCNP
VTGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGI
TGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGLCECREGFVGNRCDQCEENYF
YNRSWPGCQECPACYRLVKEKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAER
EVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVEN
TERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRV
AKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA
GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEHLIDQKLKDYEDLREDMRGKELE
VKNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDN
KTAAEEALRKIPAINQTITEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNA
TSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAE
INARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSD
LENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
NT seq 4830 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtagccatcgggccgcgccggccctgtggccccgggggcggctctggcccgtg
ctggccgtgctggcggcggccgccgcggcgggctgtgcccaggcagccatggacgagtgc
acggacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaac
gtgaccgtggtggccaccaacacgtgtgggactccgcccgaggaatactgtgtgcagacc
ggggtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcag
cacggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagc
cagaccatgctggccggggtgcagtaccccagctccatcaacctcacgctgcacctggga
aaagcttttgacatcacctatgtgcgtctcaagttccacaccagccgcccggagagcttt
gccatttacaagcgcacactggaagacgggccctggattccttaccagtactacagtggt
tcctgcgagaacacctactccaaggcaaaccgcggcttcatcaggacaggaggggacgag
cagcaggccttgtgtactgatgaattcagtgacatttctcccctcactgggggcaacgtg
gccttttctaccctggaaggaaggcccagcgcctataactttgacaatagccctgtgctg
caggaatgggtaactgccactgacatcagagtaactcttaatcgcctgaacacttttgga
gatgaagtgtttaacgatcccaaagttctcaagtcctattattatgccatctctgatttt
gctgtgggtggcagatgtaaatgtaatggacacgcaagcgagtgtatgaagaacgaattt
gataagctggtgtgtaattgcaaacataacacatatggagtagactgtgaaaagtgtctt
cctttcttcaatgaccggccgtggaggagggcaactgcggaaagtgccagtgaatgcctg
ccctgtgattgcaatggtcgatcccaggaatgctacttcgaccctgaactctatcgttcc
actggccatgggggccactgtaccaactgccaggataacacagatggcgcccactgtgag
aggtgccgggagaacttcttccgccttggaaacaatgaagcctgctctccatgccattgt
agtcctgtgggctctctaagcacacagtgtgatagttacggcagatgcagctgtaagcca
ggagtgatgggggacaaatgtgaccgttgccagcctggattccattctctcactgaagca
ggatgcaggccatgctcttgtgatccctctggcagcatagatgaatgtaatgttgaaaca
ggaagatgtgtttgcaaagacaatgtcgaaggcttcaattgtgaaagatgcaaacctgga
ttttttaatctggaatcatctaatcctcggggttgcacaccctgcttctgctttgggcat
tcttctgtctgtacaaacgctgttggctacagtgtttattctatctcctctacctttcag
attgatgaggatgggtggcgtgtggaacagagagatggctctgaagcatctctcgagtgg
tcctctgagaggcaagatatcgccgtgatctcagatagctactttcctcggtacttcatt
gctcctgcaaagttcttgggcaagcaggtgttgagttatggtcagaacctctccttctcc
tttcgagtggacaggcgagatactcgcctctctgcagaagaccttgtgcttgagggagct
ggcttaagagtatctgtacccttgatcgctcagggcaattcctatccaagtgagaccact
gtgaagtatgtcttcaggctccatgaagcaacagattacccttggaggcctgctcttacc
ccttttgaatttcagaagctcttaaacaacttgacctctatcaagatacgtgggacatac
agtgagagaagtgctggatatttggatgatgtcaccctggcaagtgctcgtcctgggcct
ggagtccctgcaacttgggtggagtcctgcacctgtcctgtgggatatggtgggcagttt
tgtgagatgtgcctctcaggttacagaagagaaactcctaatcttggaccatacagtcca
tgtgtgctttgcgcctgcaatggacacagcgagacctgtgatcctgagacaggtgtttgt
aactgcagagacaatacggctggcccgcactgtgagaagtgcagtgatgggtactatgga
gattcaactgcaggcacctcctccgattgccaaccctgtccgtgtcctggaggttcaagt
tgtgctgttgttcccaagacaaaggaggtggtttgcaccaactgtcctactggcaccact
ggtaagagatgtgagctctgtgatgatggctactttggagaccccctgggtagaaacggc
cctgtgagactttgccgcctgtgccagtgcagtgacaacattgatcccaacgcagttgga
aattgcaatcgcttgacgggagaatgcctgaagtgcatctataacactgctggcttctat
tgtgaccggtgcaaagacggattttttggaaatcccctggctcccaatccagcagacaaa
tgcaaagcctgcaattgcaatccgtatgggaccatgaagcagcagagcagctgtaacccc
gtgacggggcagtgtgaatgtttgcctcacgtgactggccgggactgtggtgcttgtgac
cctggattctacaatctgcagagtgggcaaggctgtgagaggtgtgactgccatgccttg
ggctccaccaatgggcagtgtgacatccgcaccggccagtgtgagtgccagcctggcatc
actggtcagcactgtgagcgctgtgaggtcaaccactttgggtttggacctgaaggctgc
aaaccctgtgactgtcatcctgagggatctctttcacttcagtgcaaagatgatggtctc
tgtgaatgcagagaaggctttgtgggaaatcgctgtgaccagtgtgaagaaaactatttc
tacaatcggtcttggcctggctgccaggaatgtccagcttgttaccggctggtaaaggaa
aaggttgctgatcatagagtgaagctccaggaattagagagtctcatagcaaaccttgga
actggggatgagatggtgacagatcaagccttcgaggatagactaaaggaagcagagagg
gaagttatggacctccttcgtgaggcccaggatgtcaaagatgttgaccagaatttgatg
gatcgcctacagagagtgaataacactctgtccagccaaattagccgtttacagaatatc
cggaataccattgaagagactggaaacttggctgaacaagcgcgtgcccatgtagagaac
acagagcggttgattgaaatcgcatccagagaacttgagaaagcaaaagtcgctgctgcc
aatgtgtcagtcactcagccagaatctacaggggacccaaacaacatgactcttttggca
gaagaggctcgaaagcttgctgaacgtcataaacaggaagctgatgacattgttcgagtg
gcaaagacagccaatgatacgtcaactgaggcatacaacctgcttctgaggacactggca
ggagaaaatcaaacagcatttgagattgaagagcttaataggaagtatgaacaagcgaag
aacatctcacaggatctggaaaaacaagctgcccgagtacatgaggaggccaaaagggcc
ggtgacaaagctgtggagatctatgccagcgtggctcagctgagccctttggactctgag
acactggagaatgaagcaaataacataaagatggaagctgagaatctggaacatctgatt
gaccagaaattaaaagattatgaggacctcagagaagatatgagagggaaggaacttgaa
gtcaagaaccttctggagaaaggcaagactgaacagcagactgcagaccaactcctagcc
cgagctgatgctgccaaggccctcgctgaggaagctgcaaagaagggacgggatacctta
caagaagctaatgacattctcaacaacctgaaagattttgataggcgcgtgaacgataac
aagacagccgcagaggaggcactaaggaagattcctgccatcaaccagaccatcactgaa
gccaatgaaaagaccagggaagcccagcaggccctgggcaatgctgcggcggatgccaca
gaggccaagaacaaggcccatgaggcggagaggatcgcgagcgctgtccaaaagaatgcc
accagcaccaaggcagaagctgaaagaacttttgcagaagttacagatctggataatgag
gtgaacaatatgttgaagcaactgcaggaagcagaaaaagagctaaagagaaaacaagat
gacgctgaccaggacatgatgatggcagggatggcttcacaggctgctcaagaagccgag
atcaatgccagaaaagccaaaaactctgttactagcctcctcagcattattaatgacctc
ttggagcagctggggcagctggatacagtggacctgaataagctaaatgagattgaaggc
accctaaacaaagccaaagatgaaatgaaggtcagcgatcttgataggaaagtgtctgac
ctggagaatgaagccaagaagcaggaggctgccatcatggactataaccgagatatcgag
gagatcatgaaggacattcgcaatctggaggacatcaggaagaccttaccatctggctgc
ttcaacaccccgtccattgaaaagccctag

DBGET integrated database retrieval system