KEGG   Pan troglodytes (chimpanzee): 457570Help
Entry
457570            CDS       T01005                                 

Gene name
LAMC1
Definition
laminin, gamma 1 (formerly LAMB2)
Orthology
K05635  
laminin, gamma 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Prion diseases
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:ptr04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:ptr04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:ptr04510]
Human Diseases; Cancers; Pathways in cancer [PATH:ptr05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:ptr05222]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:ptr05020]
Human Diseases; Infectious diseases; Amoebiasis [PATH:ptr05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:ptr05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 1609 aa AA seqDB search
MRGSHRAAPALWPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFN
VTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQS
QTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTLEDGPWIPYQYYSG
SCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVL
QEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEF
DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRS
TGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKP
GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPG
FFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRVEQRDGSEASLEW
SSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGA
GLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTY
SERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSP
CVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSS
CAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG
NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNPYGTMKQQSSCNP
VTGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGI
TGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGLCECREGFVGNRCDQCEENYF
YNRSWPGCQECPACYRLVKEKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAER
EVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVEN
TERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRV
AKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA
GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEHLIDQKLKDYEDLREDMRGKELE
VKNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDN
KTAAEEALRKIPAINQTITEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNA
TSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAE
INARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSD
LENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
NT seq 4830 nt NT seq  +upstreamnt  +downstreamnt
atgaggggtagccatcgggccgcgccggccctgtggccccgggggcggctctggcccgtg
ctggccgtgctggcggcggccgccgcggcgggctgtgcccaggcagccatggacgagtgc
acggacgagggcgggcggccgcagcgctgcatgcccgagttcgtcaacgccgccttcaac
gtgaccgtggtggccaccaacacgtgtgggactccgcccgaggaatactgtgtgcagacc
ggggtgaccggggtcaccaagtcctgtcacctgtgcgacgccgggcagccccacctgcag
cacggggcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagc
cagaccatgctggccggggtgcagtaccccagctccatcaacctcacgctgcacctggga
aaagcttttgacatcacctatgtgcgtctcaagttccacaccagccgcccggagagcttt
gccatttacaagcgcacactggaagacgggccctggattccttaccagtactacagtggt
tcctgcgagaacacctactccaaggcaaaccgcggcttcatcaggacaggaggggacgag
cagcaggccttgtgtactgatgaattcagtgacatttctcccctcactgggggcaacgtg
gccttttctaccctggaaggaaggcccagcgcctataactttgacaatagccctgtgctg
caggaatgggtaactgccactgacatcagagtaactcttaatcgcctgaacacttttgga
gatgaagtgtttaacgatcccaaagttctcaagtcctattattatgccatctctgatttt
gctgtgggtggcagatgtaaatgtaatggacacgcaagcgagtgtatgaagaacgaattt
gataagctggtgtgtaattgcaaacataacacatatggagtagactgtgaaaagtgtctt
cctttcttcaatgaccggccgtggaggagggcaactgcggaaagtgccagtgaatgcctg
ccctgtgattgcaatggtcgatcccaggaatgctacttcgaccctgaactctatcgttcc
actggccatgggggccactgtaccaactgccaggataacacagatggcgcccactgtgag
aggtgccgggagaacttcttccgccttggaaacaatgaagcctgctctccatgccattgt
agtcctgtgggctctctaagcacacagtgtgatagttacggcagatgcagctgtaagcca
ggagtgatgggggacaaatgtgaccgttgccagcctggattccattctctcactgaagca
ggatgcaggccatgctcttgtgatccctctggcagcatagatgaatgtaatgttgaaaca
ggaagatgtgtttgcaaagacaatgtcgaaggcttcaattgtgaaagatgcaaacctgga
ttttttaatctggaatcatctaatcctcggggttgcacaccctgcttctgctttgggcat
tcttctgtctgtacaaacgctgttggctacagtgtttattctatctcctctacctttcag
attgatgaggatgggtggcgtgtggaacagagagatggctctgaagcatctctcgagtgg
tcctctgagaggcaagatatcgccgtgatctcagatagctactttcctcggtacttcatt
gctcctgcaaagttcttgggcaagcaggtgttgagttatggtcagaacctctccttctcc
tttcgagtggacaggcgagatactcgcctctctgcagaagaccttgtgcttgagggagct
ggcttaagagtatctgtacccttgatcgctcagggcaattcctatccaagtgagaccact
gtgaagtatgtcttcaggctccatgaagcaacagattacccttggaggcctgctcttacc
ccttttgaatttcagaagctcttaaacaacttgacctctatcaagatacgtgggacatac
agtgagagaagtgctggatatttggatgatgtcaccctggcaagtgctcgtcctgggcct
ggagtccctgcaacttgggtggagtcctgcacctgtcctgtgggatatggtgggcagttt
tgtgagatgtgcctctcaggttacagaagagaaactcctaatcttggaccatacagtcca
tgtgtgctttgcgcctgcaatggacacagcgagacctgtgatcctgagacaggtgtttgt
aactgcagagacaatacggctggcccgcactgtgagaagtgcagtgatgggtactatgga
gattcaactgcaggcacctcctccgattgccaaccctgtccgtgtcctggaggttcaagt
tgtgctgttgttcccaagacaaaggaggtggtttgcaccaactgtcctactggcaccact
ggtaagagatgtgagctctgtgatgatggctactttggagaccccctgggtagaaacggc
cctgtgagactttgccgcctgtgccagtgcagtgacaacattgatcccaacgcagttgga
aattgcaatcgcttgacgggagaatgcctgaagtgcatctataacactgctggcttctat
tgtgaccggtgcaaagacggattttttggaaatcccctggctcccaatccagcagacaaa
tgcaaagcctgcaattgcaatccgtatgggaccatgaagcagcagagcagctgtaacccc
gtgacggggcagtgtgaatgtttgcctcacgtgactggccgggactgtggtgcttgtgac
cctggattctacaatctgcagagtgggcaaggctgtgagaggtgtgactgccatgccttg
ggctccaccaatgggcagtgtgacatccgcaccggccagtgtgagtgccagcctggcatc
actggtcagcactgtgagcgctgtgaggtcaaccactttgggtttggacctgaaggctgc
aaaccctgtgactgtcatcctgagggatctctttcacttcagtgcaaagatgatggtctc
tgtgaatgcagagaaggctttgtgggaaatcgctgtgaccagtgtgaagaaaactatttc
tacaatcggtcttggcctggctgccaggaatgtccagcttgttaccggctggtaaaggaa
aaggttgctgatcatagagtgaagctccaggaattagagagtctcatagcaaaccttgga
actggggatgagatggtgacagatcaagccttcgaggatagactaaaggaagcagagagg
gaagttatggacctccttcgtgaggcccaggatgtcaaagatgttgaccagaatttgatg
gatcgcctacagagagtgaataacactctgtccagccaaattagccgtttacagaatatc
cggaataccattgaagagactggaaacttggctgaacaagcgcgtgcccatgtagagaac
acagagcggttgattgaaatcgcatccagagaacttgagaaagcaaaagtcgctgctgcc
aatgtgtcagtcactcagccagaatctacaggggacccaaacaacatgactcttttggca
gaagaggctcgaaagcttgctgaacgtcataaacaggaagctgatgacattgttcgagtg
gcaaagacagccaatgatacgtcaactgaggcatacaacctgcttctgaggacactggca
ggagaaaatcaaacagcatttgagattgaagagcttaataggaagtatgaacaagcgaag
aacatctcacaggatctggaaaaacaagctgcccgagtacatgaggaggccaaaagggcc
ggtgacaaagctgtggagatctatgccagcgtggctcagctgagccctttggactctgag
acactggagaatgaagcaaataacataaagatggaagctgagaatctggaacatctgatt
gaccagaaattaaaagattatgaggacctcagagaagatatgagagggaaggaacttgaa
gtcaagaaccttctggagaaaggcaagactgaacagcagactgcagaccaactcctagcc
cgagctgatgctgccaaggccctcgctgaggaagctgcaaagaagggacgggatacctta
caagaagctaatgacattctcaacaacctgaaagattttgataggcgcgtgaacgataac
aagacagccgcagaggaggcactaaggaagattcctgccatcaaccagaccatcactgaa
gccaatgaaaagaccagggaagcccagcaggccctgggcaatgctgcggcggatgccaca
gaggccaagaacaaggcccatgaggcggagaggatcgcgagcgctgtccaaaagaatgcc
accagcaccaaggcagaagctgaaagaacttttgcagaagttacagatctggataatgag
gtgaacaatatgttgaagcaactgcaggaagcagaaaaagagctaaagagaaaacaagat
gacgctgaccaggacatgatgatggcagggatggcttcacaggctgctcaagaagccgag
atcaatgccagaaaagccaaaaactctgttactagcctcctcagcattattaatgacctc
ttggagcagctggggcagctggatacagtggacctgaataagctaaatgagattgaaggc
accctaaacaaagccaaagatgaaatgaaggtcagcgatcttgataggaaagtgtctgac
ctggagaatgaagccaagaagcaggaggctgccatcatggactataaccgagatatcgag
gagatcatgaaggacattcgcaatctggaggacatcaggaagaccttaccatctggctgc
ttcaacaccccgtccattgaaaagccctag

DBGET integrated database retrieval system