KEGG   Pan troglodytes (chimpanzee): 457596Help
Entry
457596            CDS       T01005                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     457596 (UCHL5)
Peptidases [BR:ptr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   457596 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 192 aa AA seqDB search
MKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREG
PIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAE
EPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAE
HQQLIPLVEKIF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcttggcactgagcaattcagatgtgattcgacaagtacacaacagtttcgcc
agacagcaaatgtttgaatttgatacgaagacatcagcaaaagaagaagatgcttttcac
tttgtcagttatgttcctgttaatgggagactgtatgaattagatggattaagagaagga
ccgattgatttaggtgcatgcaatcaagatgattggatcagtgcagtaaggcctgtcata
gaaaaaaggatacaaaagtacagtgaaggtgaaattcgatttaatttaatggccattgtg
tctgacagaaaaatgatatatgagcagaagatagcagagttacaaagacaacttgcagag
gaacccatggatacagatcaaggtaatagtatgttaagtgctattcagtcagaagttgcc
aaaaatcagatgcttattgaagaagaagtacagaaattaaaaagatacaagattgagaat
atcagaaggaagcataattatctgcctttcattatggaattgttaaagactttagcagaa
caccagcagttaataccactagtagaaaagatattctga

DBGET integrated database retrieval system