KEGG   Pan troglodytes (chimpanzee): 457747Help
Entry
457747            CDS       T01005                                 

Gene name
BPNT1
Definition
3'(2'), 5'-bisphosphate nucleotidase 1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ptr00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 366 aa AA seqDB search
MPSFSRLIDSAKARYWTQRGTWVYDNALLLLLKCLWSNVVPGLSPFLSCRSGQEPECTMA
SSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSL
ARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGT
KEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQL
KEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPG
CKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESI
KNALVP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccatccttctcaagacttattgacagtgccaaagctcggtactggacacagcgaggg
acctgggtctacgataacgcgcttttgctcctcctgaagtgtctttggtccaacgttgtt
ccaggtttgtcaccgtttctctcctgccggtcagggcaagagccagagtgtaccatggct
tccagtaacactgtgttgatgcggttggtagcctctgcatattctattgctcaaaaggca
ggaatgatagtcagacgtgttattgctgaaggagacctgggtattgtggagaagacctgt
gcaacagacctgcagaccaaagctgaccgattggcacagatgagcatatgttcttcattg
gcccggaaattccccaaactcacaattataggggaagaggatctgccttctgaggaagtg
gatcaagagctgattgaagacagtcagtgggaagaaatactgaagcaaccatgcccatcg
cagtacagtgctattaaagaagaagatctcgtggtctgggttgatcctctggatggaacc
aaggaatataccgaaggtcttcttgacaatgtaacagttcttattggaattgcttatgaa
ggaaaagccatagcaggagttattaaccagccatattacaactatgaggcaggaccagat
gctgtgttggggaggacaatctggggagttttaggtttaggcgcctttgggtttcagctg
aaagaagtccctgctgggaaacacattatcacaactactcgatcccatagcaacaagttg
gttactgactgtgttgctgctatgaaccccgatgctgtgctgcgagtaggaggagcagga
aataagattattcagctgattgaaggcaaagcctctgcttatgtatttgcaagtcctggt
tgtaagaagtgggatacttgtgctccagaagttattttacatgctgtgggaggcaagtta
accgatatccatgggaatgttcttcagtaccacaaggatgtgaagcatatgaactctgca
ggagtcctggccacactgaggaattatgactactatgcaagccgagttccagaatctatt
aaaaatgcacttgttccttaa

DBGET integrated database retrieval system