KEGG   Pan troglodytes (chimpanzee): 457945Help
Entry
457945            CDS       T01005                                 

Gene name
MTOR, FRAP1
Definition
mechanistic target of rapamycin (serine/threonine kinase)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Acute myeloid leukemia
Central carbon metabolism in cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    457945 (MTOR)
   04066 HIF-1 signaling pathway
    457945 (MTOR)
   04151 PI3K-Akt signaling pathway
    457945 (MTOR)
   04152 AMPK signaling pathway
    457945 (MTOR)
   04150 mTOR signaling pathway
    457945 (MTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    457945 (MTOR)
   04920 Adipocytokine signaling pathway
    457945 (MTOR)
   04919 Thyroid hormone signaling pathway
    457945 (MTOR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    457945 (MTOR)
   05230 Central carbon metabolism in cancer
    457945 (MTOR)
   05231 Choline metabolism in cancer
    457945 (MTOR)
   05206 MicroRNAs in cancer
    457945 (MTOR)
   05205 Proteoglycans in cancer
    457945 (MTOR)
   05214 Glioma
    457945 (MTOR)
   05221 Acute myeloid leukemia
    457945 (MTOR)
   05215 Prostate cancer
    457945 (MTOR)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    457945 (MTOR)
Protein kinases [BR:ptr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   457945 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 2522 aa AA seqDB search
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILXTQREPKEMQKLSGTGFWGNC
NPKHEEWPPFTLERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITPFTSFQAVQPQQS
NALVGLLGYSSHQGLMGFGTSPSPAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSL
IQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSVAVRSE
FKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLARAMGPGIQQDIKELLEP
MLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHPGMPKGLAHQLAS
PGLTTLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCS
RLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLASLDERFDAHL
AQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQILTELEHSGIG
RIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVINNVLATIGELAQ
VSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVVEPYRKYPTLLEV
LLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSS
DYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSLGLKCV
QFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYMDEIVTLMREFWVMNTS
IQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSPGRIVSIKLLAAIQLFGANL
DDYLHLLLPPIVKLFDAPEAPLPSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSP
ELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEE
DPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVSKDDWLEWLRRL
SLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQDELIRSIELALTS
QDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYKELEFQKG
PTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKM
DTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAWGLGQWD
SMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAY
GAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQKILMVRSLVVSPH
EDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKS
ARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINES
TIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKKKLRHASGANITN
ATTAATTAATATTTASTEGSNSESEAESTENSPTPSPLQKKVTEDLSKTLLMYTVPAVQG
FFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARID
TPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQ
QAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKE
TSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVS
PKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLK
GHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLH
ALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKS
PSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMT
REKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLL
NWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGL
VKPEALNKKAIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCP
FW
NT seq 7569 nt NT seq  +upstreamnt  +downstreamnt
atgcttggaaccggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagc
gtcctgcagcagtttgccagtggcctaaagagccggaatgaggaaaccagggccaaagcc
gccaaggagctccagcactatgtcactatggaactccgagagatgagtcaagaggagtct
actcgcttctatgaccaactgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagctagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggccgtcttgccatggcaggggacactttt
accgctgagtacgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacatgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcaacccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgtagccgcccttcgtgcctgtctgattctcnac
acccagcgtgagccgaaagagatgcagaagctcagtggtacagggttctggggaaattgt
aaccctaaacatgaagagtggccacccttcactttggaacgtctgagagaagaaatggaa
gaaatcacacagcagcagctggtacacgacaagtactgcaaagatctcatgggcttcgga
acaaaacctcgtcacattacccccttcaccagtttccaggctgtacagccccagcagtca
aatgccttggtggggctgctggggtacagctctcaccaaggcctcatgggatttgggacc
tcccccagtccagctaagtccaccctggtggagagccggtgttgcagagacttgatggag
gagaaatttgatcaggtgtgccagtgggtgctgaaatgcaggaatagcaagaactcgctg
atccaaatgacaatccttaatttgttgccccgcttggctgcattccgaccttctgccttc
acagatacccagtatctccaagataccatgaaccatgtcctaagctgtgtcaagaaggag
aaggaacgtacagcggccttccaagccctggggctactttccgtggctgtgaggtctgag
tttaaggtctatttgcctcgcgtgctggacatcatccgagcggccctgcccccaaaggac
ttcgcccataagaggcagaaggcaatgcaggtggacgccacagtcttcacttgcatcagc
atgctggctcgagcaatggggccaggcatccagcaggatatcaaggagctgctggagccc
atgctggcagtgggactaagccctgccctcactgcagtgctctacgacctgagccgtcag
attccacagctaaagaaggacattcaagatgggctactgaaaatgctgtccctggtcctt
atgcacaaacccctccgccacccaggcatgcccaagggcctggcccatcagctggcctct
cctggcctcacgaccctccctgaggccagcgatgtgggcagcatcactcttgccctccga
acgcttggcagctttgaatttgaaggccactctctgacccaatttgttcgccactgtgcg
gatcatttcctgaacagtgagcacaaggagatccgcatggaggctgcccgcacctgctcc
cgcctgctcacaccctccatccacctcatcagtggccatgctcatgtggttagccagact
gcagtgcaagtggtggcagatgtgcttagcaaactgctcgtagttgggataacagatcct
gaccctgacattcgctattgtgtcttggcgtccctggacgagcgctttgatgcacacctg
gcccaggcggagaacttgcaggccttgtttgtggctctgaatgaccaggtgtttgagatc
cgggagctggccatctgcactgtgggccgactcagtagcatgaaccctgcctttgtcatg
cctttcctgcgcaagatgctcatccagattttgacagagttggagcacagtgggattgga
agaatcaaagagcagagtgcccgcatgctggggcacctggtctccaatgccccccgactc
atccgcccctacatggagcctattctgaaggcattaattttgaaactgaaagatccagac
cctgatccaaacccaggtgtgatcaataatgtcctagcaacaataggagaattggcacag
gttagtggcctggaaatgaggaaatgggttgatgaactttttattatcatcatggacatg
ctccaggattcctctttgttggccaaaaggcaggtggctctgtggaccctgggacagttg
gtggccagcactggctatgtagtagagccctacaggaagtaccctactttgcttgaggtg
ctactgaattttctgaagactgagcagaaccagggtacacgcagagaggccatccgtgtg
ttagggcttttaggggctttggatccttacaagcacaaagtgaacattggcatgatagac
cagtcccgggatgcctctgctgtcagcctgtcagaatccaagtcaagtcaggattcctct
gactatagcactagtgaaatgctggtcaacatgggaaacttgcctctggatgagttctac
ccagctgtgtccatggtggccctgatgcggatcttccgagaccagtcactctctcatcat
cacaccatggttgtccaggccatcaccttcatcttcaagtccctgggactcaaatgtgtg
cagttcctgccccaggtcatgcccacgttccttaatgtcattcgagtctgtgatggggcc
atccgggaatttttgttccagcagctgggaatgttggtgtcctttgtgaagagccacatc
agaccttatatggatgaaatagtcaccctcatgagagaattctgggtcatgaacacctca
attcagagcacgatcattcttctcattgagcaaattgtggtagctcttgggggtgaattt
aagctctacctgccccagctgatcccacacatgctgcgtgtcttcatgcatgacaacagc
ccaggccgcattgtctctatcaagttactggctgcaatccagctgtttggcgccaacctg
gatgactacctgcatttactgctgcctcctattgttaagttgtttgatgcccctgaagct
ccactgccatctcgaaaggcagcgctagagactgtggaccgcctgacggagtccctggat
ttcactgactatgcctcccggatcattcaccctattgttcgaacactggaccagagccca
gaactgcgctccacagccatggacacgctgtcttcacttgtttttcagctggggaagaag
taccaaattttcattccaatggtgaataaagttctggtgcgacaccgaatcaatcatcag
cgctatgatgtgctcatctgcagaattgtcaagggatacacacttgctgatgaagaggag
gatcctttgatttaccagcatcggatgcttaggagtggccaaggggatgcattggctagt
ggaccagtggaaacaggacccatgaagaaactgcacgtcagcaccatcaacctccaaaag
gcctggggcgctgccaggagggtctccaaagatgactggctggaatggctgagacggctg
agcctggagctgctgaaggactcatcatcgccctccctgcgctcctgctgggccctggca
caggcctacaacccgatggccagggatctcttcaatgctgcatttgtgtcctgctggtct
gaactgaatgaagatcaacaggatgagctcatcagaagcatcgagttggccctcacctca
caagacatcgctgaagtcacacagaccctcttaaacttggctgaattcatggaacacagt
gacaagggccccctgccactgagagatgacaatggcattgttctgctgggtgagagagct
gccaagtgccgagcatatgccaaagcactacactacaaagaactggagttccagaaaggc
cccacccctgccattctagaatctctcatcagcattaataataagctacagcagccggag
gcagcggccggagtgttagaatatgccatgaaacactttggagagctggagatccaggct
acctggtatgagaaactgcacgagtgggaggatgcccttgtggcctatgacaagaaaatg
gacaccaacaaggacgacccagagctgatgctgggccgcatgcgctgcctcgaggccttg
ggggaatggggtcaactccaccagcagtgctgcgaaaagtggaccctggttaatgatgag
acccaagccaagatggcccggatggctgctgcagctgcatggggtttaggtcagtgggac
agcatggaagaatacacctgtatgatccctcgggacacccatgatggggcattttataga
gctgtgctggcactgcatcaggacctcttctccttggcacaacagtgcattgacaaggcc
agggacctgctggatgctgaattaactgcgatggcaggagagagttacagtcgggcatat
ggggccatggtttcttgccacatgctgtccgagctggaggaggttatccagtacaaactt
gtccccgagcgacgagagatcatccgccagatctggtgggagagactgcagggctgccag
cgtatcgtagaggactggcagaaaatccttatggtgcggtcccttgtggtcagtcctcat
gaagacatgagaacctggctcaagtatgcaagcctgtgcggcaagagtggcaggctggct
cttgctcataaaactttagtgttgctcctgggagttgatccgtctcggcaacttgaccat
cctctgccaacagttcaccctcaggtgacctatgcctacatgaaaaacatgtggaagagt
gcccgcaagatcgatgccttccagcacatgcagcattttgtccagaccatgcagcaacag
gcccagcatgccatcgctactgaggaccagcagcataagcaggaactgcacaagctcatg
gcccgatgcttcctgaaacttggagagtggcagctgaatctacagggcatcaatgagagc
acaatccccaaagtgctgcagtactacagcgccgccacagagcacgaccgcagctggtac
aaggcctggcatgcgtgggcagtgatgaacttcgaagctgtgctacactacaaacatcag
aaccaagcccgcgatgagaagaagaaactgcgtcatgccagcggggccaacatcaccaac
gccaccactgccgccaccacggccgccactgccaccaccactgccagcaccgagggcagc
aacagtgagagcgaggccgagagcaccgagaacagccccaccccatcgccgctgcagaag
aaggtcactgaggatctgtccaaaaccctcctgatgtacacggtgcctgccgtccagggc
ttcttccgttccatctccttgtcacgaggcaacaacctccaggatacactcagagttctc
accttatggtttgattatggtcactggccagatgtcaatgaggccttagtggagggggtg
aaagccatccagattgatacctggctacaggttatacctcagctcattgcaagaattgat
acgcccagacccttggtgggacgtctcattcaccagcttctcacagacattggtcggtac
cacccccaggccctcatctacccgctgacagtggcttctaagtctaccacgacagcccgg
cacaatgcagccaacaagattctgaagaacatgtgtgagcacagcaacaccctggtccag
caggccatgatggtgagcgaggagctgatccgagtggccatcctctggcatgagatgtgg
catgaaggcctggaagaggcatctcgtttgtactttggggaaaggaacgtgaaaggcatg
tttgaggtgctggagcccttgcatgctatgatggaacggggcccccagactctgaaggaa
acatcctttaatcaggcctatggtcgagatttaatggaggcccaagagtggtgcaggaag
tacatgaaatcagggaatgtcaaggacctcacccaagcctgggacctctattatcatgtg
ttccgacgaatctcaaagcagctgcctcagctcacatccttagagctgcaatatgtttcc
ccaaaacttctgatgtgccgggaccttgaattggctgtgccaggaacatatgaccccaac
cagccaatcattcgcattcagtccatagcaccgtctttgcaagtcatcacatccaagcag
aggccccggaaattgacacttatgggcagcaacgggcatgagtttgttttccttctaaaa
ggccatgaagatctgcgccaggatgagcgtgtgatgcagctcttcggcctggttaacacc
cttctggccaatgacccaacatctcttcggaaaaacctcagcatccagagatatgctgtc
atccctttatcgaccaactcgggcctcattggctgggttccccactgtgacacactgcac
gctctcatccgggactacagggagaagaagaagatccttctcaacatcgagcatcgcatc
atgttgcggatggctccggactatgaccacttgactctgatgcagaaggtggaggtgttt
gagcatgccgtcaataatacagctggggacgacctggccaagctgctgtggctgaaaagc
cccagctctgaggtgtggtttgaccgaagaaccaattatacccgttctttagcggtcatg
tcaatggttgggtatattttaggcctgggagatagacacccatccaacctgatgctggac
cgtctgagtgggaagatcctgcacattgactttggggactgctttgaggttgctatgacc
cgagagaagtttccagagaagattccatttagactaacaagaatgttgaccaatgctatg
gaggttacaggcctggatggcaactacagaatcacatgccacacagtgatggaggtgctg
cgagagcacaaggacagtgtcatggccgtgctggaagcctttgtctatgaccccttgctg
aactggaggctgatggacacaaatacgaaaggcaacaagcgatcccgaacgaggacggat
tcctactctgctggccagtcagtcgaaattttggacggtgtggaacttggagagccagcc
cataagaaaacggggaccacagtgccagaatctattcattctttcattggagacggtttg
gtgaaaccagaggccctaaataagaaagctatccagattattaacagggttcgagataag
ctcactggtcgggacttctctcatgatgacactttggatgttccaacgcaagttgagctg
ctcatcaaacaagcgacatcccatgaaaacctctgccagtgctatattggctggtgccct
ttctggtaa

DBGET integrated database retrieval system