KEGG   Pan troglodytes (chimpanzee): 458253Help
Entry
458253            CDS       T01005                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04020  Calcium signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04072  Phospholipase D signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04919  Thyroid hormone signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05167  Kaposi's sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05214  Glioma
ptr05223  Non-small cell lung cancer
ptr05225  Hepatocellular carcinoma
ptr05231  Choline metabolism in cancer
Module
ptr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    458253 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    458253 (PLCG1)
   04015 Rap1 signaling pathway
    458253 (PLCG1)
   04012 ErbB signaling pathway
    458253 (PLCG1)
   04370 VEGF signaling pathway
    458253 (PLCG1)
   04064 NF-kappa B signaling pathway
    458253 (PLCG1)
   04066 HIF-1 signaling pathway
    458253 (PLCG1)
   04020 Calcium signaling pathway
    458253 (PLCG1)
   04070 Phosphatidylinositol signaling system
    458253 (PLCG1)
   04072 Phospholipase D signaling pathway
    458253 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    458253 (PLCG1)
   04660 T cell receptor signaling pathway
    458253 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    458253 (PLCG1)
   04659 Th17 cell differentiation
    458253 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    458253 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    458253 (PLCG1)
   04670 Leukocyte transendothelial migration
    458253 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    458253 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    458253 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    458253 (PLCG1)
  Development
   04360 Axon guidance
    458253 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    458253 (PLCG1)
   05231 Choline metabolism in cancer
    458253 (PLCG1)
   05206 MicroRNAs in cancer
    458253 (PLCG1)
   05205 Proteoglycans in cancer
    458253 (PLCG1)
   05225 Hepatocellular carcinoma
    458253 (PLCG1)
   05214 Glioma
    458253 (PLCG1)
   05223 Non-small cell lung cancer
    458253 (PLCG1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    458253 (PLCG1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    458253 (PLCG1)
   05169 Epstein-Barr virus infection
    458253 (PLCG1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    458253 (PLCG1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     458253 (PLCG1)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    458253 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    458253 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 PH C2 SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 458253
NCBI-ProteinID: XP_009435516
Ensembl: ENSPTRG00000013500
Position
20
AA seq 1330 aa AA seqDB search
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVGQSVFPVIL
LILLGHCKPLPTSHPILSQGDLKPFVVAFTVDNGLNPVWPAKPFHFQISNPEFAFLRFVV
YEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLIKIDIFPAKQENGDL
SPFSGTSLRERGSDATGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPR
RTRVNGDNRL
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccttgcgccaacggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgccgacaagatcgagggggctattgacattcgtgaaattaaggag
atccgcccagggaagacctcacgggactttgatcgctatcaagaggacccagctttccgg
ccggaccagtcacattgctttgtcattctctatggaatggaatttcgcctgaaaacgctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacattgcaggcacccacacccctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcaactgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttacgagagatcgaggagccatacttcttcctggatgagtttgtcact
ttcctgttctccaaagagaacagtgtgtggaactcgcagctggatgcagtatgcccggac
accatgaacaaccctctttcccactactggatctcctcctcgcacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccggatgggatgccagttatttaccat
gggcacacccttaccaccaagatcaagttctcagatgtcctgcacaccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagaggaacatggcccaatacttcaagaaggtgctgggggacacactcctcaccaag
cccgtggagatctctgccgacgggctcccctcacccaaccagcttaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactctatcaagaatggcatcctctacctggaggaccct
gtgaaccacgaatggtatccccactactttgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcgtcacatcgctgagcgcctgcttactgagtactgcatcgagaccggagcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaacgggaaagtccagcactgccgtatccactcccggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacgcactaccag
caggtgcccctgcgctgtaatgagtttgagatgcgactttcagagcctgtcccacagacc
aacgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctaatgcgtgtccctcgtgatggggccttcctggtgcggaagcggaatgagcccaac
tcatatgccatctctttccgggctgagggcaagatcaagcattgccgtgtccagcaagag
ggccagacagtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaaacacccgctataccgcaagatgaagctgcgctatcccatcaacgaggaggca
ctggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcagtcaaagccctcttt
gactacaaggcccagagggaggacgagctgaccttcaccaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactacgtggaagagatggtcaaccccgtggccctggagccggagagggag
cacttggacgagaacagccccctaggggacttgctacggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgccgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagacagcagacgccaggctcactgaaggg
aagataatggaacggaggaagaagattgccctggagctctctgaacttgtcgtctactgc
cggcctgttcccttcgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagcttgtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggccctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctattgaggtgctgggggcccgacatctg
ccaaagaatggccgaggcattgtgtgtccttttgtggagattgaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtgggtcagtctgtcttcccagtcatcctc
ctcatcctgctggggcactgcaagcctctccccaccagtcatcccatcctctcccagggt
gacctgaagccttttgtcgttgccttcacagtggacaatggactcaaccctgtatggcca
gccaagcccttccacttccagatcagtaaccctgaatttgcctttctgcgcttcgtggtg
tatgaggaagacatgtttagtgaccagaatttcctggctcaggctactttcccagtaaaa
ggcctgaagacaggatacagagcagtgcctttgaagaataactacagtgaggacctggag
ttggcctccctgctgatcaagattgacattttccctgccaagcaggagaatggtgacctc
agtcccttcagtggtacgtccctgcgggagcggggctcagatgccacaggccagctgttt
cacggccgagcccgggaaggctcctttgaatcccgctaccagcagccgtttgaggacttc
cgcatctcccaggagcatctcgcagaccattttgacagtcgagaacgaagggccccaaga
aggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system