KEGG   Pan troglodytes (chimpanzee): 458253Help
Entry
458253            CDS       T01005                                 

Gene name
PLCG1
Definition
phospholipase C, gamma 1
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Thyroid hormone signaling pathway
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Choline metabolism in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    458253 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    458253 (PLCG1)
   04015 Rap1 signaling pathway
    458253 (PLCG1)
   04012 ErbB signaling pathway
    458253 (PLCG1)
   04370 VEGF signaling pathway
    458253 (PLCG1)
   04064 NF-kappa B signaling pathway
    458253 (PLCG1)
   04066 HIF-1 signaling pathway
    458253 (PLCG1)
   04020 Calcium signaling pathway
    458253 (PLCG1)
   04070 Phosphatidylinositol signaling system
    458253 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    458253 (PLCG1)
   04660 T cell receptor signaling pathway
    458253 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    458253 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    458253 (PLCG1)
   04670 Leukocyte transendothelial migration
    458253 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    458253 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    458253 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    458253 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    458253 (PLCG1)
   05231 Choline metabolism in cancer
    458253 (PLCG1)
   05206 MicroRNAs in cancer
    458253 (PLCG1)
   05205 Proteoglycans in cancer
    458253 (PLCG1)
   05214 Glioma
    458253 (PLCG1)
   05223 Non-small cell lung cancer
    458253 (PLCG1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    458253 (PLCG1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     458253 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 1291 aa AA seqDB search
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDATGQLFHGRAREGSFESRYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccttgcgccaacggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgccgacaagatcgagggggctattgacattcgtgaaattaaggag
atccgcccagggaagacctcacgggactttgatcgctatcaagaggacccagctttccgg
ccggaccagtcacattgctttgtcattctctatggaatggaatttcgcctgaaaacgctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacattgcaggcacccacacccctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcaactgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttacgagagatcgaggagccatacttcttcctggatgagtttgtcact
ttcctgttctccaaagagaacagtgtgtggaactcgcagctggatgcagtatgcccggac
accatgaacaaccctctttcccactactggatctcctcctcgcacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccggatgggatgccagttatttaccat
gggcacacccttaccaccaagatcaagttctcagatgtcctgcacaccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagaggaacatggcccaatacttcaagaaggtgctgggggacacactcctcaccaag
cccgtggagatctctgccgacgggctcccctcacccaaccagcttaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactctatcaagaatggcatcctctacctggaggaccct
gtgaaccacgaatggtatccccactactttgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcgtcacatcgctgagcgcctgcttactgagtactgcatcgagaccggagcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaacgggaaagtccagcactgccgtatccactcccggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacgcactaccag
caggtgcccctgcgctgtaatgagtttgagatgcgactttcagagcctgtcccacagacc
aacgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctaatgcgtgtccctcgtgatggggccttcctggtgcggaagcggaatgagcccaac
tcatatgccatctctttccgggctgagggcaagatcaagcattgccgtgtccagcaagag
ggccagacagtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaaacacccgctataccgcaagatgaagctgcgctatcccatcaacgaggaggca
ctggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcagtcaaagccctcttt
gactacaaggcccagagggaggacgagctgaccttcaccaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactacgtggaagagatggtcaaccccgtggccctggagccggagagggag
cacttggacgagaacagccccctaggggacttgctacggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgccgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagacagcagacgccaggctcactgaaggg
aagataatggaacggaggaagaagattgccctggagctctctgaacttgtcgtctactgc
cggcctgttcccttcgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagcttgtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggccctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctattgaggtgctgggggcccgacatctg
ccaaagaatggccgaggcattgtgtgtccttttgtggagattgaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtggtggacaatggactcaaccctgtatgg
ccagccaagcccttccacttccagatcagtaaccctgaatttgcctttctgcgcttcgtg
gtgtatgaggaagacatgtttagtgaccagaatttcctggctcaggctactttcccagta
aaaggcctgaagacaggatacagagcagtgcctttgaagaataactacagtgaggacctg
gagttggcctccctgctgatcaagattgacattttccctgccaagcaggagaatggtgac
ctcagtcccttcagtggtacgtccctgcgggagcggggctcagatgccacaggccagctg
tttcacggccgagcccgggaaggctcctttgaatcccgctaccagcagccgtttgaggac
ttccgcatctcccaggagcatctcgcagaccattttgacagtcgagaacgaagggcccca
agaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system