KEGG   Pan troglodytes (chimpanzee): 458441Help
Entry
458441            CDS       T01005                                 

Gene name
ACSS2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    458441 (ACSS2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    458441 (ACSS2)
   00620 Pyruvate metabolism
    458441 (ACSS2)
   00640 Propanoate metabolism
    458441 (ACSS2)
Enzymes [BR:ptr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     458441 (ACSS2)
Lipid biosynthesis proteins [BR:ptr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   458441 (ACSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 702 aa AA seqDB search
MMGLPEERGRSGSGSRGQEEAGAGGRARSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPR
EFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGD
KFAFYWEGNEPGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLA
CARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQE
KGFPVRCCIVVKHLGRAELGMGDSPSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDE
CEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADI
GWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKF
GDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLP
GATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETT
YFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAV
VGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRS
GKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFSHRCLTIQ
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgatggggcttcctgaggagcggggccggagcggcagcgggagccggggccaggaggaa
gctggagccggaggccgggcgcggagttggtctccgccgcccgaggtcagccgctccgcg
cacgtcccctcgctgcagcgctaccgcgagctgcaccggcgctccgtggaggagccgcgg
gaattctggggagacattgccaaggaattttactggaagactccatgccctggcccattc
cttcggtacaactttgatgtgactaaagggaaaatcttcattgagtggatgaaaggagca
actaccaacatctgctacaatgtactggatcgaaatgtccatgagaaaaagcttggagat
aaatttgctttttactgggagggcaatgagccaggggagaccactcagatcacataccat
cagcttctggtccaagtgtgtcagttcagcaatgttctccgaaaacagggcattcagaag
ggggaccgagtggccatctacatgcctatgatcccagagcttgtggtggccatgctggca
tgtgcccgcattggggctttgcactccattgtgtttgcaggcttctcttcagagtctcta
tgtgaacggatcttggattccagctgcagtcttctcatcactacagatgccttctacagg
ggggaaaagcttgtgaacctgaaggagctggctgacgaggccctgcagaagtgtcaggag
aagggtttcccagtaagatgctgcattgtggtcaagcacctggggcgggcagagctcggc
atgggtgactcccccagccagtcccccccaattaagaggtcatgcccggatgtgcagatc
tcatggaaccaagggattgacttgtggtggcatgagctcatgcaagaggcaggggatgag
tgtgagcccgagtggtgtgatgccgaggacccactcttcatcctgtacaccagtggctcc
acaggcaaacccaagggtgtggttcacacagttgggggctacatgctctatgtagccaca
accttcaagtatgtgtttgacttccatgcagaggatgtgttctggtgcacggcagacatt
ggttggatcactggtcattcctacgtcacctatgggccactggccaatggtgccaccagt
gttttgtttgaggggattcccacatatccggacgtgaaccgcctgtggagcattgtggac
aaatacaaggtgaccaagttctacacagcacccacagccatccgtctgctcatgaagttt
ggagatgagcctgtcaccaagcatagccgggcatccttgcaggtgttaggcacagtgggt
gaacccatcaaccctgaggcctggctatggtaccaccgggtggtaggtgcccagcgctgc
cccatcgtggacaccttctggcaaacagagacaggtggccacatgttgactccccttcct
ggtgccacacccatgaaacccggttctgctactttcccattctttggtgtagctcctgca
atcctgaatgagtccggggaagagttggaaggtgaagctgaaggttatctggtgttcaag
cagccctggccagggatcatgcgcacagtctatgggaaccacgaacgctttgagacaacc
tactttaagaagtttcctggatactatgttacaggagatggctgccagcgggaccaggat
ggctattactggatcactggcaggattgatgacatgctcaatgtatctggacacctgctg
agtacagcggaggtggagtcagcacttgtggaacatgaggctgttgcagaggcagctgtg
gtgggccaccctcatcctgtgaagggtgaatgcctctactgctttgtcaccttgtgtgat
ggccacaccttcagccccaagctcaccgaggagctcaagaagcagattagagaaaagatt
ggccccattgccacaccagactacatccagaatgcacctggcttgcctaaaacccgctca
gggaaaatcatgaggcgagtgcttcggaagattgctcagaatgaccatgacctcggggac
atgtctactgtggctgacccatctgtcatcagtcacctcttcagccaccgctgcctgacc
atccagtga

DBGET integrated database retrieval system