KEGG   Pan troglodytes (chimpanzee): 458441Help
Entry
458441            CDS       T01005                                 

Gene name
ACSS2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ptr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ptr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ptr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ptr00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 702 aa AA seqDB search
MMGLPEERGRSGSGSRGQEEAGAGGRARSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPR
EFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGD
KFAFYWEGNEPGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLA
CARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQE
KGFPVRCCIVVKHLGRAELGMGDSPSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDE
CEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADI
GWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKF
GDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLP
GATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETT
YFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAV
VGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRS
GKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFSHRCLTIQ
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgatggggcttcctgaggagcggggccggagcggcagcgggagccggggccaggaggaa
gctggagccggaggccgggcgcggagttggtctccgccgcccgaggtcagccgctccgcg
cacgtcccctcgctgcagcgctaccgcgagctgcaccggcgctccgtggaggagccgcgg
gaattctggggagacattgccaaggaattttactggaagactccatgccctggcccattc
cttcggtacaactttgatgtgactaaagggaaaatcttcattgagtggatgaaaggagca
actaccaacatctgctacaatgtactggatcgaaatgtccatgagaaaaagcttggagat
aaatttgctttttactgggagggcaatgagccaggggagaccactcagatcacataccat
cagcttctggtccaagtgtgtcagttcagcaatgttctccgaaaacagggcattcagaag
ggggaccgagtggccatctacatgcctatgatcccagagcttgtggtggccatgctggca
tgtgcccgcattggggctttgcactccattgtgtttgcaggcttctcttcagagtctcta
tgtgaacggatcttggattccagctgcagtcttctcatcactacagatgccttctacagg
ggggaaaagcttgtgaacctgaaggagctggctgacgaggccctgcagaagtgtcaggag
aagggtttcccagtaagatgctgcattgtggtcaagcacctggggcgggcagagctcggc
atgggtgactcccccagccagtcccccccaattaagaggtcatgcccggatgtgcagatc
tcatggaaccaagggattgacttgtggtggcatgagctcatgcaagaggcaggggatgag
tgtgagcccgagtggtgtgatgccgaggacccactcttcatcctgtacaccagtggctcc
acaggcaaacccaagggtgtggttcacacagttgggggctacatgctctatgtagccaca
accttcaagtatgtgtttgacttccatgcagaggatgtgttctggtgcacggcagacatt
ggttggatcactggtcattcctacgtcacctatgggccactggccaatggtgccaccagt
gttttgtttgaggggattcccacatatccggacgtgaaccgcctgtggagcattgtggac
aaatacaaggtgaccaagttctacacagcacccacagccatccgtctgctcatgaagttt
ggagatgagcctgtcaccaagcatagccgggcatccttgcaggtgttaggcacagtgggt
gaacccatcaaccctgaggcctggctatggtaccaccgggtggtaggtgcccagcgctgc
cccatcgtggacaccttctggcaaacagagacaggtggccacatgttgactccccttcct
ggtgccacacccatgaaacccggttctgctactttcccattctttggtgtagctcctgca
atcctgaatgagtccggggaagagttggaaggtgaagctgaaggttatctggtgttcaag
cagccctggccagggatcatgcgcacagtctatgggaaccacgaacgctttgagacaacc
tactttaagaagtttcctggatactatgttacaggagatggctgccagcgggaccaggat
ggctattactggatcactggcaggattgatgacatgctcaatgtatctggacacctgctg
agtacagcggaggtggagtcagcacttgtggaacatgaggctgttgcagaggcagctgtg
gtgggccaccctcatcctgtgaagggtgaatgcctctactgctttgtcaccttgtgtgat
ggccacaccttcagccccaagctcaccgaggagctcaagaagcagattagagaaaagatt
ggccccattgccacaccagactacatccagaatgcacctggcttgcctaaaacccgctca
gggaaaatcatgaggcgagtgcttcggaagattgctcagaatgaccatgacctcggggac
atgtctactgtggctgacccatctgtcatcagtcacctcttcagccaccgctgcctgacc
atccagtga

DBGET integrated database retrieval system