KEGG   Pan troglodytes (chimpanzee): 458648Help
Entry
458648            CDS       T01005                                 

Gene name
CLTCL1
Definition
(RefSeq) clathrin heavy chain like 1
  KO
K04646  
clathrin heavy chain
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    458648 (CLTCL1)
   04142 Lysosome
    458648 (CLTCL1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    458648 (CLTCL1)
  Nervous system
   04721 Synaptic vesicle cycle
    458648 (CLTCL1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    458648 (CLTCL1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    458648 (CLTCL1)
Membrane trafficking [BR:ptr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    458648 (CLTCL1)
Exosome [BR:ptr04147]
 Exosomal proteins
  Proteins found in most exosomes
   458648 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 1718 aa AA seqDB search
MAQILPVRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLAGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCICMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGCKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSRMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLRAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYKGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYHNNLQRYIEIYVQKVNPSRTPAVIGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVCRKDPELWAHVL
EENNPSRRQLIDQVGTDSRCQKHGILKRFRSLFKAFMTADLPNELIELLEKIVLDNSVFK
RARHLKVAVALAVFLNTRFSNMQCWSIGSTHSHLYSAGPCRSMHSHLYDAGPVLLPLPQL
LLIWLLHYTSVCLKQRPSRVCARPNAGVQNKTQIIGFLLVTDSKNYQWDRAVLCVLPLPV
LRGESSLPMRAVRAVWEVAVDDGKRGVVRRRCRVGWRRRVWPEVRGYGRQRWCGSAVDAL
KHGVVGSVDDGKEGGAAWRCQWMTEEGLLGSAADAREGSEVGDRCYEEGMYEAAKLLYSN
VSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFACVDGQEFRFAQLCGLHIVIHA
DELEELMCYYQDRGYFEELILLLEAALGLERAHMGMFTELAILYSKFKPQKMLEHLELFW
SRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMMSHPTEAWKEGQFKDIITKVAN
VELCYRALQFYLDYKPLLINDLLLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNN
KSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNW
WAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECFAACLFTCYDLLRPD
MVLELAWRHNLVDLAMPYFIQVMREYLSKVDKLDALESLRKQEEHVTEPAPLVFGPAVGP
APASFPYGYASAPNFASLQCTTSAYSGRCHHPPYLQSY
NT seq 5157 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctccctgttcgctttcaggagcacttccagctccaaaaccttggaatt
aatccagctaacattggattcagcacactgaccatggaatctgacaagttcatatgtatc
cgagagaaagttggtgagcaggcacaggtcacgatcattgacatgagtgacccaatggct
ccgatccgacggcctatctctgcagagagtgccatcatgaatccagcctctaaggtgata
gctctgaaagctgggaagacacttcagatctttaatattgagatgaagagtaaaatgaag
gctcatactatggcagaagaagtgattttctggaaatgggtttctgtgaacactgttgcc
ttggtgaccgagaccgcggtctaccactggagcatggaaggtgactcccagcccatgaag
atgtttgatagacataccagtctggcgggctgccaggtgattcactaccggactgatgag
taccagaagtggctgctgctcgtaggcatctcggctcagcaaaaccgtgtggttggagca
atgcagctctactctgtggataggaaggtttcacaacccatagaaggccatgctgcggct
tttgcagagttcaagatggaggggaatgccaagcctgccacccttttctgctttgctgta
cgtaatcccacaggaggcaagttgcacatcattgaagttggacagcctgcagcgggaaac
caaccttttgtaaagaaagcagtggatgtgttttttcctccagaggcacagaatgatttt
ccagtggctatgcagattggagctaaacatggtgttatttacttgatcacaaagtatggc
tatcttcatctgtacgacctagagtctggcgtgtgcatctgcatgaaccgtattagtgct
gacacaatatttgtcactgctccacacaaaccaacctctggaattattggtgtcaacaaa
aagggacaggtactgtcagtttgtgttgaggaagataacattgtgaattatgcaaccaac
gtgcttcagaatccagaccttggtctgcgtttggccgttcgtagtaacctggctggggca
gagaagttgtttgtgagaaaattcaataccctctttgcacagggcagctatgctgaagcc
gccaaagttgcagcgtctgcaccaaagggaatcctgcgtaccagagagacggtccagaaa
ttccagagtatacccgctcagtctggccaggcttctccattgctgcagtacttcggaatc
ctgctcgaccagggtcagctcaataaacttgaatccttagaactttgccatctggttctt
cagcaggggtgtaagcaactcctagagaagtggctgaaagaagataagctggagtgctca
gaggagctcggagacttggtcaaaaccactgaccccatgctcgctctgagtgtgtacctt
cgggcaaatgtgccaagcaaagtgatccagtgttttgcagaaacaggccaattccagaaa
attgtgctctatgccaaaaaggttgggtacaccccagactggatctttctgctgaggggt
gtaatgaagatcagtccggaacagggcctgcagttttctcgaatgctagtgcaggacgag
gagccgctggccaacattagccagattgtggacattttcatggaaaacagtttaattcag
cagtgtacttccttcttattggatgccttgaagaataatcgcccagctgagggactcctg
cagacatggctgttggagatgaaccttgttcatgcaccccaggttgcagatgccatcctt
ggaaataaaatgtttactcattacgaccgggcccacattgcccagctctgtgagaaggca
ggcctcctgcagcaagcactggagcactacaccgacctctatgacatcaagagggctgtg
gtccacactcacctcctcaatcccgagtggcttgtcaatttctttggctccttatcggtg
gaggattctgtggagtgtctgcgtgccatgctgtctgctaacatcagacagaaccttcag
ctgtgtgtgcaggtggcctctaagtaccacgagcagctgggcacgcaggccctggtggag
ctctttgaatccttcaagagttacaaaggcctcttctacttcctgggctcaatcgtgaac
ttcagccaagacccagatgtgcatctgaaatacattcaggctgcctgtaagacagggcag
atcaaggaggtggagaggatatgccgagagagcagctgctacaacccagagcgtgtgaag
aacttcctgaaggaggccaagctcacagaccagcttcccctcatcatcgtgtgtgatcgt
tttggctttgtccatgaccttgtcctatatttataccacaacaacctgcagaggtacatt
gagatctacgtgcagaaggtcaaccctagccggaccccagctgtgattggagggctgctt
gatgtggattgttctgaggaagtgattaaacatttaatcatggcagtgagaggacagttc
tctactgatgagttggtggctgaagtagaaaaaagaaataggctcaagctgctgcttccc
tggctggagtcccagattcaggaaggctgtgaggagcctgccactcacaatgcactggct
aaaatctacatcgacagcaacaacagccccgagtgcttcctgagagagaatgcctactat
gacagcagcgtggtgggccgctactgtgagaagcgagacccccatctggcctgtgttgcc
tatgagcgggggcagtgtgaccttgagctcatcaaggtgtgcaatgagaattctctgttc
aaaagcgaggcccgctacctggtatgcagaaaggatccggagctctgggctcacgtcctt
gaggagaacaacccatccaggagacagctaattgaccaggttggtacagacagccgttgt
cagaaacacgggatcctgaagagatttcggtcactgttcaaagcctttatgacagccgac
ctgcctaatgaactgattgaactgctggagaagatagttctggataactctgtcttcaag
cgagcaaggcacttaaaggtggctgtagctcttgctgtcttcttaaacactcgcttctca
aacatgcagtgctggtccatcggaagcacgcactcgcacctctatagtgccggtccatgc
agaagcatgcactcccacctctatgatgccgggcctgtgctgctgcccctgccacagctc
ctgctcatctggcttctacattatacctcggtgtgtttgaagcagaggccgagcagagtg
tgtgctcgaccaaatgctggcgtccagaacaagacgcagatcattggttttctgctcgtg
acagactccaagaattatcagtgggaccgggctgtgctttgtgttctaccgttaccggtg
ctgcggggagagtcatccttaccaatgagggccgtccgtgcggtctgggaggtagccgtg
gatgacggcaagcgaggggttgtgcggcgacggtgccgtgttggatggcgaaggagggtg
tggcccgaggtgcgtggatacggaaggcagcggtggtgcgggagtgccgtggatgcgctg
aagcatggggtggtggggagcgtggatgacggtaaggaggggggtgcggcgtggaggtgc
cagtggatgacggaagaggggcttttggggagtgccgctgatgcgcgagaaggcagcgag
gttggagaccgctgttacgaggagggaatgtacgaggctgccaagctgctctatagcaat
gtttctaactttgcccgcctggcttccaccttggttcacctcggtgagtatcaggcagca
gtggacaacagccgcaaggccagcagcacccggacatggaaggaggtgtgctttgcctgt
gtggatggacaggagttccgctttgcacagctgtgtggtcttcacatcgtcattcatgca
gatgagctggaggagctgatgtgctattaccaggatcgtggctactttgaggagctgatc
ttgctgttggaagcggccctgggcctggagcgggcccacatgggcatgttcactgagctg
gccatcctctactccaaattcaagccacagaagatgctggagcatctggagcttttctgg
tcccgtgtcaacatcccaaaggtgctgagggctgcagagcaggcacacctgtgggctgag
ctggtgttcctctatgacaagtacgaggagtatgacaatgctgtgctcaccatgatgagc
caccccactgaggcctggaaggagggtcagttcaaggacatcattaccaaggttgccaac
gtcgagctctgttacagagccctgcagttctatttggattacaaaccactgctcatcaat
gacctgctgctggtgctttcaccccggctggaccacacctggacagtcagtttcttttca
aaggcaggtcagctgcccctggtgaagccttacctgcggtcagtccagagccacaacaac
aagagtgtgaatgaggcactcaaccacctgctgacagaggaggaggactatcagggctta
agggcatctatcgatgcctatgacaactttgacaacatcagcctggctcagcagctggag
aagcatcagctgatggagttcaggtgcattgcggcctatctgtacaagggcaataactgg
tgggcccagagcgtggagctctgcaagaaggatcatctctacaaggatgccatgcagcat
gctgcagagtcgcgggatgctgagctggcccagaagttgctgcagtggttcctggaggaa
ggcaagagggagtgcttcgcagcttgtctcttcacctgctatgacctgcttcgcccagac
atggtgcttgaactggcctggaggcacaacctcgtggacttggccatgccctacttcatc
caggtgatgagggagtacctgagcaaggtggacaaactggatgccttggagagtctgcgc
aagcaagaggagcatgtgacagagcctgcccctctcgtgtttggccctgccgtgggccca
gcccctgccagcttcccctatggatatgcctctgctcccaacttcgccagcctccaatgt
acaacttccgcgtatagtgggcgttgtcaccacccaccctacctgcagagttactaa

DBGET integrated database retrieval system