KEGG   Pan troglodytes (chimpanzee): 458883Help
Entry
458883            CDS       T01005                                 

Gene name
CYB5R3, DIA1
Definition
cytochrome b5 reductase 3
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    458883 (CYB5R3)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     458883 (CYB5R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
22
AA seq 278 aa AA seqDB search
MKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSA
RIDGNLVVRPYTPVSSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFR
GPNGLLVYQGKGKFAIRPDKKSNPVIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTV
CHLLFANQTEKDILLRPELEELRNEHSARFKLWYTLDRAPEAWDYSQGFVNEEMIRDHLP
PPEEEPLVLMCGPPPMIQYACLPNLDRVGHPKERCFAF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttccagcgctccacgccagccatcaccctcgagagcccggacatcaagtac
ccgctgcggctcatcgaccgggagatcatcagccatgacacccggcgcttccgctttgcc
ctgccgtcaccccagcacatcctgggcctccctgtcggccagcacatctacctctcggct
cgaattgatggaaacctggtcgtccggccctatacacccgtctccagtgatgatgacaag
ggcttcgtggacctggtcatcaaggtttacttcaaggacacccatcccaagtttcccgcc
ggagggaagatgtctcagtacctggagagcatgcagattggagacaccattgagttccgg
ggccccaacgggctgctggtctaccagggcaaagggaagttcgccatccgacctgacaaa
aagtccaaccctgtcatcaggacagtgaagtctgtgggcatgatcgcgggagggacaggc
atcaccccgatgctgcaggtgatccgtgccatcatgaaggaccctgatgaccacactgtg
tgccacctgctctttgccaaccagaccgagaaggacatcctgctgcgacctgagctggag
gaactcaggaacgaacattctgcacgcttcaagctctggtacacgctggacagagcccct
gaagcctgggactacagccagggcttcgtgaatgaggagatgatccgggaccaccttcca
cccccagaggaggagccgctagtgctgatgtgtggccccccacccatgatccagtacgcc
tgccttcccaacctggaccgcgtgggccaccccaaggagcgctgcttcgccttctga

DBGET integrated database retrieval system