KEGG   Pan troglodytes (chimpanzee): 458941Help
Entry
458941            CDS       T01005                                 

Gene name
TYMP, ECGF1
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ptr00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:ptr00983]
Human Diseases; Cancers; Bladder cancer [PATH:ptr05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 163 aa AA seqDB search
MRLQGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSEQLVPADGILYAARDVTAT
VDSLPLITASILSKKLVEGLSALVVDVKFGGAAVFPNQEQARELAKTLVGVGASLGLRVA
AALTAMDKPLGRCVGHALEVEEALLCMDGAGPPNLRDLVTTLR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgcaaggaggcaccttggataagctggagtctattcctggattcaatgtcatc
cagagcccagagcagatgcaagtgctgctggaccaggcgggctgctgtatcgtgggtcag
agtgagcagctggttcctgcggacggaatcctatatgcagccagagatgtgacagccacc
gtggacagcctgccactcatcacagcctccattctcagtaagaaactcgtggaggggctg
tccgctctggtggtggacgttaagttcggaggggccgccgtcttccccaaccaggagcag
gcccgggagctggcaaagacgctggttggcgtgggagccagcctagggcttcgggtcgcg
gcagcgctgaccgccatggacaagcccctgggtcgctgcgtgggccacgccctggaggtg
gaggaggcgctgctctgcatggacggcgcaggtccaccaaacttaagggacctggtcacc
acccttcggtga

DBGET integrated database retrieval system