KEGG   Pan troglodytes (chimpanzee): 458941Help
Entry
458941            CDS       T01005                                 

Gene name
TYMP, ECGF1
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    458941 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    458941 (TYMP)
 Human Diseases
  Cancers
   05219 Bladder cancer
    458941 (TYMP)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     458941 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 482 aa AA seqDB search
MAALMTPGTGAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAA
VVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGG
VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQA
GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAA
VFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPP
NLRDLVTTLGGALLWLSGHAETQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARAL
CSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG
AELLVDVGQRLRRGTPWLRVHRDGPALSGLQSRALQEALVLSDRAPFTAPSPFAELVLPP
QQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcagccttgatgaccccgggaaccggggccccacccgcgcctggtgacttctccggg
gaagggagccagggacttcccgacccttcgccagagcccaagcagctcccggagctgatc
cgcatgaagcgagacggaggccgcctgagcgaagcggacatcaggggcttcgtggccgct
gtggtgaatgggagcgcgcagggcgcacagatcggggccatgctgatggccatccgactt
cggggcatggatctggaggagacctcggtgctgacccaggccctggcccagtcgggacag
cagctggagtggccagaggcctggcgccagcagcttgtggacaagcattccacagggggt
gtgggtgacaaggtcagcctggtcctcgcacctgccctggcggcatgcggctgcaaggtg
ccaatgatcagcggacgtggtctggggcacacaggaggcaccttggataagctggagtct
attcctggattcaatgtcatccagagcccagagcagatgcaagtgctgctggaccaggcg
ggctgctgtatcgtgggtcagagtgagcagctggttcctgcggacggaatcctatatgca
gccagagatgtgacagccaccgtggacagcctgccactcatcacagcctccattctcagt
aagaaactcgtggaggggctgtccgctctggtggtggacgttaagttcggaggggccgcc
gtcttccccaaccaggagcaggcccgggagctggcaaagacgctggttggcgtgggagcc
agcctagggcttcgggtcgcggcagcgctgaccgccatggacaagcccctgggtcgctgc
gtgggccacgccctggaggtggaggaggcgctgctctgcatggacggcgcaggtccacca
aacttaagggacctggtcaccacgctcgggggcgccctgctctggctcagcggacacgcg
gagactcaggcccagggcgctgcccgggtggccgcggcgctggacgacggctcggccctt
ggccgcttcgagcggatgctggcggcgcagggcgtggatcccggtctggcccgagccctg
tgctcgggaagtcccgcagagcgccggcagctgctgcctcgcgcccgggagcaggaggag
ctgctggcgcccgcagatggcaccgtggagctggtccgggcgctgccgctggcgctggtg
ctgcacgagctcggggccgggcgcagccgcgctggggagccgctccgcctgggggtgggc
gcagagctgctggtcgacgtgggtcagaggctgcgccgtgggaccccctggctccgcgtg
caccgggacggccccgcgctcagcggcctgcagagccgcgccctgcaggaggcgctcgta
ctctccgaccgcgcgccattcaccgccccctcgcccttcgcagagctcgttctgccgccg
cagcaataa

DBGET integrated database retrieval system