KEGG   Pan troglodytes (chimpanzee): 458950Help
Entry
458950            CDS       T01005                                 

Gene name
ACR
Definition
acrosin
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     458950 (ACR)
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   458950 (ACR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 395 aa AA seqDB search
MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSL
QIFTYNGHRYHTCGGSLLNSRWVLTAAHCFTGKNNVHDWRLVFGAKEITYGNNKPVKAPL
QERYVEKIIIHEKYNSATEGNDIALVKITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVA
GWGYIEEKAPTLTVGMSGDSHRLPLPCAPVDTWGDSGGPLMCKDSKESAYVVVGITSWGV
GCARAKRPGIYTATWPYLNWIASKIGSNALHMIQSATRPPPTTRPPPIRPPFSHPISAHL
PWYFQPPPRPLPPRPPAAQPRPPPSPLPPPPPPPSTLPPPPPPPTPSSTTKLPQGLSFAK
RLQQLVEVLKGKTYPDGKNHYDMETTELPELTSTS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgctaccaactgccattctgctggtcttggcagtgtccgtggttgctaaa
gataacgccacgtgtgatggcccctgtgggttacggttcaggcaaaacccacagggtggt
gtccgcatcgtcggcgggaaggctgcacagcatggggcctggccctggatggtcagcctc
cagatcttcacatacaacggccacaggtaccacacatgtggaggcagcttgctgaattca
cgatgggtgctcactgctgctcactgcttcactggcaaaaataatgtgcatgactggaga
ctggttttcggagcaaaggaaattacatatgggaacaataaaccagtaaaggcgcctctg
caagagagatacgtggagaaaatcatcattcatgaaaaatacaactctgcgacagaggga
aatgacattgccctcgtgaagatcacccctcccatttcgtgtgggcgcttcattgggccg
ggctgcctgccccactttaaggcaggcctccccagaggctcccagagctgctgggtggct
ggctggggatatatagaagagaaagcacctactctcacagtggggatgagcggtgacagc
caccgactgcccctgccgtgtgcccctgtggacacctggggggacagcggcgggcctctc
atgtgcaaagacagcaaggaaagcgcctatgtggtcgtgggaatcacaagctggggggta
ggctgtgcccgtgccaagcgccccggaatctacacggccacctggccctatctgaactgg
atcgcctccaagattggttccaacgctttgcatatgattcaatcggccacccgtccacct
cccactactcgaccgcccccgattcgaccccccttctcccaccctatctccgctcacctt
ccttggtatttccaaccgccccctcgaccacttccaccccgaccacctgcagcccagccc
cgacccccaccttcacccctgcccccacccccacctccaccctcaactttacccccaccc
ccacccccacctacaccctcatctaccacaaaacttccccaaggactttcttttgccaag
cgcctacagcagctcgtagaggtcttgaaggggaaaacctatcctgacggaaagaaccat
tatgacatggagaccacagagctcccagaactgacctcgacctcctga

DBGET integrated database retrieval system