KEGG   Pan troglodytes (chimpanzee): 459163Help
Entry
459163            CDS       T01005                                 

Gene name
CYP1B1
Definition
cytochrome P450 1B1
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    459163 (CYP1B1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    459163 (CYP1B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    459163 (CYP1B1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    459163 (CYP1B1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    459163 (CYP1B1)
   05204 Chemical carcinogenesis
    459163 (CYP1B1)
Enzymes [BR:ptr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     459163 (CYP1B1)
Cytochrome P450 [BR:ptr00199]
 Cytochrome P450, animal type
  CYP1 family
   459163 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2A
AA seq 543 aa AA seqDB search
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLGSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPSF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSDDGGARLDLENVPATVTDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPVKWPNPENFDPARFLDKDGFINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCNFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQKLQAKE
TCQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccagcctcagcccgaacgacccttggccgctaaacccgctgtccatccagcag
accacgctcctgctactcctgtcggtgctggccactgtgcatgtgggccagcggctgctg
aggcaacggaggcggcagctcgggtccgcgcccccgggcccgtttgcgtggccactgatc
ggaaacgcggcggcggtgggccaggcggctcacctctcgttcgctcgcctggcgcggcgc
tacggcgacgttttccagatccgcctgggcagctgccccatagtggtgctgaatggcgag
cgcgccatccaccaggccctggtgcagcagggctcggccttcgccgaccggccgtccttc
gcctccttccgtgtggtgtccggcggccgcagcatggctttcggccactactcggagcac
tggaaggtgcagcggcgcgcagcccacagcatgatgcgcaacttcttcacgcgccagccg
cgcagccgccaagtcctcgagggccacgtgctgagcgaggcgcgcgagctggtggcgctg
ctggtgcgcggcagcgcggacggcgccttcctcgacccgaggccgctgaccgtcgtggcc
gtggccaacgtcatgagtgccgtgtgtttcggctgccgctacagccacgacgaccccgag
ttccgtgagctgctcagccacaacgaagagttcgggcgcacggtgggcgcgggcagcctg
gtggacgttatgccctggctgcagtacttccccaacccggtgcgcaccgttttccgcgaa
ttcgagcagctcaaccgcaacttcagcaacttcatcctggacaagttcttgaggcactgc
gaaagccttcggcccggggccgccccccgcgacatgatggacgcctttatcctctctgcg
gaaaagaaggcggccggggactcggacgatggtggcgcgcggctggatttggagaacgta
ccggccactgtcactgacatcttcggcgccagccaggacaccctgtccaccgcgctgcag
tggctgctcctcctcttcaccaggtatcctgatgtgcagactcgagtgcaggcagaattg
gatcaggtcgtggggagggaccgtctgccttgtatgggtgaccagcccaacctgccctat
gtcctggccttcctttatgaagccatgcgcttctccagctttgtgcctgtcactattcct
catgccaccactgccaacacctctgtcttgggctaccacattcccaaggacactgtggtt
tttgtcaaccagtggtctgtgaatcatgacccagtgaagtggcctaacccggagaacttt
gatccagctcgattcttggacaaggacggcttcatcaacaaggacctgaccagcagagtg
atgattttttcagtgggcaaaaggcggtgcatcggcgaagaactttctaagatgcagctt
tttctcttcatctccatcctggctcaccagtgcaatttcagggccaacccaaatgagcct
gcgaaaatgaatttcagttatggtctaaccattaaacccaagtcatttaaagtcaatgtc
actctcagagagtccatggagctccttgatagtgctgtccaaaagttacaagccaaggaa
acttgccaataa

DBGET integrated database retrieval system