KEGG   Pan troglodytes (chimpanzee): 459166Help
Entry
459166            CDS       T01005                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    459166
   00052 Galactose metabolism
    459166
Enzymes [BR:ptr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     459166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2A
AA seq 170 aa AA seqDB search
LLKAVDLLSLRPASAPFACQIVVHVFKNETWAFINFVFCLFPSGEVAPVQGTAFDLRKPV
ELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDG
TLKGKNGAVYPKHSGFCLETQNWPDAVNQFPFQHGIIWRQRNLEDNSRIL
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
cttctgaaagctgttgatttgctcagcttaagaccagcttctgcgcctttcgcgtgtcag
attgttgtgcacgtgttcaagaatgagacttgggcatttatcaactttgttttctgtctc
ttcccatcaggagaagttgccccagtgcaaggaactgcattcgacctgagaaagccagtg
gagcttggaaaacacctgcaggacttccatctcaatggttttgaccacaatttctgtctg
aagggatctaaagaaaagcatttttgtgcaagggtgcatcatgctgcaagtgggcgggta
ctagaagtatacaccacccagcccggggtccagttttacacgggcaacttcctggatggc
acattaaagggcaagaatggagctgtctatcccaagcactccggtttctgcctggagact
cagaactggcctgatgcagtcaatcagtttcctttccagcatgggatcatttggagacag
agaaacctagaggacaatagcagaatcctttaa

DBGET integrated database retrieval system