KEGG   Pan troglodytes (chimpanzee): 459273Help
Entry
459273            CDS       T01005                                 

Gene name
UGP2
Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    459273 (UGP2)
   00052 Galactose metabolism
    459273 (UGP2)
   00500 Starch and sucrose metabolism
    459273 (UGP2)
   00520 Amino sugar and nucleotide sugar metabolism
    459273 (UGP2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     459273 (UGP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2A
AA seq 497 aa AA seqDB search
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGP
SVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIG
VRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQS
RYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSN
IDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVP
KAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETA
VGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVK
LGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPG
AVLENKIVSGNLRILDH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatggtgcttctcagttccaagaagtcattcggcaagagctagaattatct
gtgaagaaggaactagaaaaaatactcaccacagcatcatcacatgaatttgagcacacc
aaaaaagacctggatggatttcggaagctatttcatagatttttgcaagaaaaggggcct
tctgtggattggggaaaaatccagagaccccctgaagattcgattcaaccctatgaaaag
ataaaggccaggggcttgcctgataatatatcttctgtgttgaacaaactagtggtggtg
aaactcaatggtggtttgggaaccagcatgggctgcaaaggccctaaaagtctgattggt
gtgaggaatgagaatacctttctggatctgactgttcagcaaattgaacatttgaataaa
acctacaatacagatgttcctcttgttttaatgaactcttttaacacggatgaagatacc
aaaaaaatactacagaagtacaatcattgtcgtgtgaaaatctacactttcaatcaaagc
aggtacccgaggattaataaagaatctttacttcctgtagcaaaggatgtgtcttactca
ggggaaaatacagaagcttggtaccctccaggtcatggtgatatttacgccagtttctac
aactctggattgcttgatacctttataggagaaggcaaagagtatatttttgtgtctaac
atagataatctgggtgccacagtggatctgtatattcttaatcatctaatgaacccaccc
aatggaaaacgctgtgaatttgtcatggaagtcacaaataaaacacgtgcagatgtaaag
ggcgggacactcactcaatatgaaggcaaactgagactggtggaaattgctcaagtgcca
aaagcacatgtagatgagttcaagtctgtatcaaagttcaaaatatttaatacaaacaac
ctatggatttctcttgcagcagttaaaagactgcaggagcaaaatgccattgacatggaa
atcattgtgaatgcaaagactttggatggaggcctgaatgtcattcaattagaaactgca
gtaggggctgccatcaaaagttttgagaattctctaggtattaatgtgccaaggagccgt
tttctgcctgtcaaaaccacatcagatctcttgctggtgatgtcaaacctctatagtctt
aatgcaggatctctgacaatgagtgaaaagcgggaatttcctacagtgcccttggttaaa
ttaggcagttcttttacaaaggttcaagattatctaagaagatttgaaagtataccagat
atgcttgaattggatcacctcacagtttcaggagatgtgacatttggaaaaaatgtttca
ttaaagggaacggttatcatcattgcaaatcatggtgacagaattgatatcccacctgga
gcagtattagagaacaagattgtgtctggaaaccttcgcatcttggaccactga

DBGET integrated database retrieval system