KEGG   Pan troglodytes (chimpanzee): 459371Help
Entry
459371            CDS       T01005                                 

Gene name
ST3GAL5, SIAT9, ST3GAL-V
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 5 (EC:2.4.99.9)
Orthology
K03370  
lactosylceramide alpha-2,3-sialyltransferase (sialyltransferase 9) [EC:2.4.99.9]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, ganglio series, LacCer => GT3
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    459371 (ST3GAL5)
Enzymes [BR:ptr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.9  lactosylceramide alpha-2,3-sialyltransferase
     459371 (ST3GAL5)
Glycosyltransferases [BR:ptr01003]
 Terminal extension
  Sialyltransferase
   459371 (ST3GAL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2A
AA seq 362 aa AA seqDB search
MRRPSLLLKDILKCTLLVFGVWILYILKLNYTTEECDMKKMHYVDPDRVKRAQTYAQQVL
QKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLE
LLPEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVEGYSEHVGN
KTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMVKNETLPFWVRLFFWKQVA
EKIPLQPKHFRILNPVIIKETAFDILQYSEPQSRFWGRDKNVPTIGVIAVVLATHLCDEV
SLAGFGYDLSQPRTPLHYFDNQCMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDR
EF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggcccagcttgttattaaaagacatcctcaaatgtacattgcttgtgtttgga
gtgtggatcctttatatcctcaagttaaattatactactgaagaatgtgacatgaaaaaa
atgcattatgtggaccctgaccgtgtaaagagagctcagacatatgctcagcaagtcttg
cagaaggaatgtcgtcccaagtttgccaagacatcaatggcgctgttatttgagcacagg
tatagcgtggacttactcccttttgtgcagaaggcccccaaagacagtgaagctgagtcc
aagtacgatcctccttttgggttccggaagttctccagtaaagtccagaccctcttggaa
ctcttgccagagcacgacctccctgaacacttgaaagccaagacctgtcggcgctgtgtg
gttattggaagcggaggaatactgcacggattagaactgggccacaccctgaaccagttc
gatgttgtgataaggttaaacagtgcaccagttgagggatattcagaacatgttggaaat
aaaactactataaggatgacttatccagagggcgcaccactgtctgaccttgaatattat
tccaatgacttatttgttgctgttttatttaagagtgttgatttcaactggcttcaagca
atggtaaaaaatgaaaccctgccattctgggtacgactcttcttttggaagcaggtggca
gaaaaaatcccactgcagccaaaacatttcaggattttgaatccagttatcatcaaagag
actgcctttgacatccttcagtactcagagcctcagtcaaggttctggggccgagataag
aacgtccccacaatcggtgtcattgccgttgtcttagccacacatctgtgcgatgaagtc
agtttggcgggttttggatatgacctcagtcaacccagaacacctttgcactacttcgac
aatcagtgcatggctgctatgaactttcagaccatgcataatgtgacaacggaaaccaag
ttcctcttaaagctggtcaaagagggagtggtgaaagatctcagcggaggcattgatcgt
gaattctga

DBGET integrated database retrieval system