KEGG   Pan troglodytes (chimpanzee): 459509Help
Entry
459509            CDS       T01005                                 

Gene name
PDIA6, TXNDC7
Definition
protein disulfide isomerase family A, member 6 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    459509 (PDIA6)
Enzymes [BR:ptr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     459509 (PDIA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2A
AA seq 440 aa AA seqDB search
MALLVLGLVSCAFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQR
LTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP
VEDDIDLSDVELDDLGKDEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctggtgctcggtctggtgagctgtgccttctttctggcagtgaatggtctg
tattcctctagtgatgatgtgatcgaattaactccatcaaatttcaaccgagaagttatt
cagagtgatagtttgtggcttgtagaattctatgctccatggtgtggtcactgtcaaaga
ttaacaccagaatggaagaaagcagcaactgcattaaaagatgttgtcaaagttggtgca
gttgatgcagataagcatcattccctaggaggtcagtatggtgttcagggatttcctacc
attaagatttttggatccaacaaaaacagaccagaagattaccaaggtggcagaactggt
gaagccattgtagatgctgcgctgagtgctctgcgccagctggtgaaggatcgcctcggg
ggacggagcggaggatacagttctggaaaacaaggcagaagtgatagttcaagtaagaag
gatgtgattgagctgacagacgacagctttgataagaatgttctggacagtgaagatgtt
tggatggttgagttctatgctccttggtgtggacactgcaaaaacctagagccagagtgg
gctgccgcagcttcagaagtaaaagagcagacgaaaggaaaagtgaaactggcagctgtg
gatgctacagtcaatcaggttctggcctcccgatacgggattagaggatttcctacaatc
aagatatttcagaaaggcgagtctcctgtggattatgacggtgggcggacaagatccgac
atcgtgtcccgggcccttgatttgttttctgataacgccccacctcctgagctgcttgag
attatcaacgaggacattgccaagaggacgtgtgaggagcaccagctctgtgttgtggct
gtgctgccccatatccttgatactggagctgcaggcagaaattcttatctggaagttctt
ctgaagttggcagacaaatacaaaaagaaaatgtgggggtggctgtggacagaagctgga
gcccagtctgaacttgagaccgcgttggggattggagggtttgggtaccccgccatggca
gccatcaatgcacgcaagatgaaatttgctctgctaaaaggctccttcagtgagcaaggc
atcaacgagtttctcagggagctctcttttgggcgtggctccacggcacctgtaggaggc
ggggctttccctaccattgttgagagagagccttgggacggcagggatggcgagcttccc
gtggaggatgacattgacctcagtgatgtggagcttgatgacttagggaaagatgagttg
tga

DBGET integrated database retrieval system